Recombinant Thiobacillus ferrooxidans Mercuric resistance protein merC (merC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Thiobacillus ferrooxidans Mercuric Resistance Protein MerC (MerC) is a membrane-associated transporter critical for mercury ion (Hg²⁺) uptake in bacterial mercury resistance systems. Derived from the acidophilic, chemolithoautotrophic bacterium Thiobacillus ferrooxidans, this protein is encoded by the merC gene, part of a unique chromosomal mercury resistance (mer) operon lacking conventional regulatory elements like merR in certain strains . Its recombinant expression in heterologous hosts like Escherichia coli enables detailed mechanistic studies and biotechnological applications .

Genetic Context and Operon Structure

The mer operon in T. ferrooxidans strain E-15 exhibits atypical organization compared to other Gram-negative bacteria:

  • Gene arrangement: merR (regulatory) → operator-promoter → merCmerA (mercuric reductase) .

  • Notable features:

    • Absence of merT and merP (common in plasmid-borne systems) .

    • Constitutive expression due to missing merR regulatory feedback in some clones .

    • Proximity to Tn7-like transposon remnants, suggesting horizontal gene transfer .

Protein Characteristics

Table 1: Biochemical Properties of Recombinant MerC

PropertyValue/DescriptionSource
Molecular Weight~16 kDa (144 amino acids)
LocalizationMembrane-bound (particulate fraction)
N-terminal SequenceS-A-I-X-R-I-I-D-K-I-G-I-V-G- (post-translational Met removal)
Structural Homology56% identity with R100 MerC; 26% with MerT

Functional Role in Mercury Resistance

MerC facilitates Hg²⁺ transport across the cell membrane, enabling detoxification via MerA-mediated reduction to volatile Hg⁰ . Key findings include:

  • Transport Mechanism:

    • Energy-independent, temperature-sensitive uptake inhibited by N-ethylmaleimide (thiol blocker) .

    • Does not require induction, unlike MerT-MerP systems .

  • Hypersensitivity Phenotype:

    • E. coli expressing MerC without MerA accumulates Hg²⁺, increasing toxicity .

    • Uptake rate: ~2.5 nmol Hg²⁺/min/mg protein (vs. 5.0 for MerT-MerP) .

Recombinant Expression and Purification

Table 2: Expression Systems for Recombinant MerC

Host SystemVector/InducerYieldApplicationsSource
E. colipTac/IPTGHighMembrane localization studies
E. colipUC18 (constitutive)ModerateHg²⁺ transport assays
T. ferrooxidansShuttle plasmidsLowGenetic engineering in native host
  • Purification: His-tagged MerC (P22905) expressed in E. coli enables affinity chromatography .

  • Activity Validation: IPTG-dependent ²⁰³Hg²⁺ uptake confirms functional expression .

Comparative Analysis with Other Mercury Transporters

Table 3: MerC vs. MerT-MerP Systems

FeatureMerC (T. ferrooxidans)MerT-MerP (Tn21/pDU1358)
Induction RequirementConstitutiveInducible by Hg²⁺
Transport EfficiencyModerate (~50% of MerT-MerP)High
Silver Ion InhibitionResistantSensitive
Genetic ContextChromosomal, merR-independentPlasmid-borne, merR-regulated

Biotechnological Applications

  • Bioremediation: Engineered T. ferrooxidans strains with recombinant merC enhance Hg²⁺ sequestration in acidic environments (e.g., mine runoff) .

  • Biosensors: MerC’s constitutive activity enables real-time Hg²⁺ detection in environmental samples .

  • Protein Engineering: Structural insights guide design of synthetic Hg²⁺ transporters .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
merC; Mercuric transport protein MerC; Mercuric resistance protein MerC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Acidithiobacillus ferrooxidans (Thiobacillus ferrooxidans)
Target Names
merC
Target Protein Sequence
MSAITRIIDKIGIVGTIVGSFSCAMCFPAAASLGAAIGLGFLSQWEGLFVQWLIPIFASV ALLATLAGWFSHRQWQRTLLGSIGPVLALVGVFGLTHHFLDKDLARVIFYTGLVVMFLVS IWDMVNPANRRCATDGCETPAPRS
Uniprot No.

Target Background

Function
This protein is involved in mercuric ion uptake.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the mercuric resistance protein MerC and how does it function in Thiobacillus ferrooxidans?

MerC is a membrane-bound protein component of the mercury resistance (mer) system in Thiobacillus ferrooxidans. Research has demonstrated that MerC functions primarily in the transport of mercuric ions across the bacterial cell membrane, serving as part of the detoxification mechanism.

When expressed in Escherichia coli, the MerC protein localizes specifically in the particulate (membrane) cell fraction rather than in the soluble cytoplasmic fraction . Functionally, the protein facilitates the uptake of 203Hg2+ in an isopropyl-1-thio-β-D-galactopyranoside (IPTG)-dependent manner when expressed under the control of the tac promoter . This suggests that MerC plays a crucial role in the initial step of mercury detoxification by facilitating the transport of mercury ions into the cell where they can be processed by other components of the mer system.

What are the optimal growth media for cultivating Thiobacillus ferrooxidans for merC studies?

Several specialized media formulations have been developed for T. ferrooxidans cultivation, each with specific advantages for genetic manipulation experiments:

  • Solid 2:2 medium: Contains a mixture of both ferrous iron and thiosulfate as energy sources at pH 4.6-4.8. This medium allows for thousands of interspersing colonies to develop on each plate without iron-oxidizing zones, making it effective for identifying recombinants .

  • 100:10 and 10:10 media: These formulations contain different ratios of ferrous iron and thiosulfate, supporting various growth patterns of T. ferrooxidans. The 100:10 medium has been used successfully for observing phenotypic variations and colony morphology .

  • TSM plates: When supplemented with appropriate antibiotics or mercury compounds, these plates can be used for selecting transformants expressing mercury resistance genes .

The choice of medium significantly impacts experimental outcomes, particularly when selecting for recombinants. For instance, on solid 2:2 medium, kanamycin and streptomycin can be effectively used to select recombinants with spontaneous antibiotic-resistant mutation rates generally lower than 10-7 .

What methods are available for measuring mercuric ion uptake in recombinant cells expressing merC?

Quantifying mercuric ion uptake in recombinant cells expressing merC typically involves:

  • Radioisotope tracking: Using 203Hg2+ as a tracer to monitor uptake into cells. This approach has been successfully employed with E. coli cells carrying a plasmid containing the tac promoter-directed merC, which demonstrated mercury uptake in an IPTG-dependent manner .

  • Mercury quantification assays: These may include:

    • Atomic absorption spectroscopy

    • Inductively coupled plasma mass spectrometry (ICP-MS)

    • Cold vapor atomic fluorescence spectroscopy (CVAFS)

  • Minimum inhibitory concentration (MIC) determinations: Testing the growth of cells in liquid media containing increasing concentrations of mercury compounds. For example, experiments with T. ferrooxidans strains showed varying susceptibilities to mercury, with minimum inhibitory concentrations differing between strains .

Each method offers different advantages in terms of sensitivity, specificity, and ability to track mercury through cellular fractions.

What are the optimal conditions for selecting transformants expressing mercury resistance genes in T. ferrooxidans?

Selecting transformants in T. ferrooxidans requires careful consideration of both selective agents and growth conditions:

Selective Agents:

Optimized Selection Parameters:
The table below summarizes key parameters for selection of mercury-resistant T. ferrooxidans transformants:

ParameterOptimal ConditionNotes
pH4.6-4.8For solid 2:2 medium
Cell density for platingVaries by strainHigh densities may show background resistance
Chloramphenicol concentration400 μg/ml for TFI70, 100 μg/ml for TFI92TFI92 is the preferred host for initial recombinant construction
Mercury concentration>2.0 μg/mlHigher concentrations needed for complete inhibition of non-transformed cells
Temperature30°CYields shortest lag phase (4-7 days) before colony expansion

When selecting transformants, plating efficiency and the time required for colony development (generally 5-7 days at 30°C) should be monitored .

How can contradictions in experimental data regarding merC function be analyzed and resolved?

Analyzing contradictions in merC functional data requires a systematic approach incorporating these methods:

  • Structured contradiction notation: Adopt a formal system for representing contradictions using parameters (α, β, θ), where α represents the number of interdependent items, β represents the number of contradictory dependencies defined by domain experts, and θ represents the minimal number of required Boolean rules to assess these contradictions . This approach helps handle the complexity of multidimensional interdependencies within datasets.

  • Data quality assessment framework: Implement frameworks that can identify contradictions as impossible combinations of values in interdependent data items . While handling a single dependency between two data items is well established, more complex interdependencies require structured evaluation methods.

  • Statistical validation: Apply statistical approaches from experimental design courses, including:

    • Analysis of variance (ANOVA) to identify significant factors affecting merC expression

    • Tests for interaction effects between experimental variables

    • Determination of proper sample sizes to achieve adequate statistical power

  • Contradiction retrieval techniques: Consider implementing novel approaches like SparseCL that leverage specially trained sentence embeddings designed to preserve subtle, contradictory nuances in research reports. This method utilizes a combined metric of cosine similarity and a sparsity function to efficiently identify contradictory data points .

When contradictions arise, researchers should consider whether phenotypic switching might be responsible. For example, T. ferrooxidans exhibits colony morphology variants with high mutation and reversion rates , which could lead to seemingly contradictory experimental results if not properly controlled.

What approaches can be used to develop a genetic system for T. ferrooxidans for the expression of recombinant merC?

Developing a functional genetic system for T. ferrooxidans requires several interconnected components:

  • Shuttle vector construction: Create vectors capable of replication in both T. ferrooxidans and E. coli. This can be achieved by:

    • Testing Thiobacillus plasmid replicons in E. coli

    • Constructing hybrid vectors with two replicons

    • Incorporating appropriate selectable markers

A library of pTFI91 subclone vectors containing a chloramphenicol resistance gene has been developed for this purpose .

  • Promoter identification and characterization: Clone and characterize T. ferrooxidans promoters to drive expression of foreign genes. A library of TFI70 promoters has been prepared by cloning genomic DNA fragments into promoter probe vectors .

  • DNA transfer methods: Establish protocols for introducing DNA into T. ferrooxidans cells. The transfer of broad-host-range plasmids belonging to incompatibility groups IncQ (pKT240 and pJRD215), IncP (pJB3Km1), and IncW (pUFR034) from E. coli to various T. ferrooxidans strains by conjugation has been successfully demonstrated .

  • Selection systems: Develop effective selection systems for identifying transformants. Mercury resistance (mer) genes from either Tn501 or from Thiobacillus strain DSM5083 can serve as selectable markers .

  • Marker exchange mutagenesis: For targeted gene disruption, transfer mobilizable suicide plasmids carrying disrupted genes from E. coli to T. ferrooxidans. This approach has been successfully used to knock out the T. ferrooxidans recA gene .

How does the phenotypic switching phenomenon in T. ferrooxidans affect mercury resistance studies?

Phenotypic switching in T. ferrooxidans presents significant challenges for mercury resistance studies:

  • Variant identification: T. ferrooxidans exhibits distinct colony morphologies on solid media, including a Large Spreading Colony (LSC) variant that spreads across the agarose surface at rates reaching 16 μm/min . This variant reverts to a parental wild type at frequencies that vary between independently arising isolates.

  • Stability considerations: When selecting and characterizing mercury-resistant transformants, researchers must consider the stability of the phenotype. A new type of colony morphology variant with high mutation and reversion rates has been observed , where approximately 5% of flat reddish colonies revert to the wild type after culturing in liquid medium for a week or more.

  • Experimental controls: To account for phenotypic switching:

    • Maintain careful documentation of colony morphologies

    • Include appropriate wild-type controls in all experiments

    • Verify phenotypic stability through repeated subculture

    • Confirm genetic identity through molecular methods such as Southern blot hybridization

  • Impact on mercury resistance expression: Phenotypic variants may differ in their ability to express mercury resistance genes. For instance, the LSC variant can be maintained in liquid thiosulfate medium for up to 6 months while retaining its variant phenotype , which may affect the expression and function of mercury resistance proteins including MerC.

What methods can be used to study the structure-function relationship of MerC in T. ferrooxidans?

Investigating the structure-function relationship of MerC requires a multi-faceted approach:

  • Protein localization studies: The MerC protein in recombinant E. coli has been found in the particulate (membrane) cell fraction, not in the soluble cytoplasmic fraction . Similar fractionation studies can be performed with T. ferrooxidans to confirm native localization.

  • Sequence analysis: The N-terminal amino acid sequence of MerC protein synthesized in E. coli (S-A-I-X-R-I-I-D-K-I-G-I-V-G-) agrees with the amino acid sequence deduced from its nucleotide sequence, except that an initiating methionine residue was removed . This information can guide the identification of functional domains.

  • Site-directed mutagenesis: Generate specific mutations in the merC gene to identify amino acid residues critical for mercury transport. This can be accomplished using the genetic systems developed for T. ferrooxidans .

  • Functional complementation: Test the ability of merC variants to complement mercury sensitivity in appropriate bacterial strains. E. coli cells carrying a plasmid containing the tac promoter-directed merC showed 203Hg2+ uptake in an IPTG-dependent manner , providing a functional assay system.

  • Comparative genomics: Analyze the merC gene and its protein product across different bacterial species to identify conserved regions likely to be functionally significant. This approach can leverage the genomic libraries constructed from T. ferrooxidans strain DSM5083 and other mercury-resistant bacteria.

How can genomic libraries be constructed to isolate and study the merC gene from T. ferrooxidans?

Construction of genomic libraries for isolating mercury resistance genes from T. ferrooxidans involves these key steps:

  • Genomic DNA extraction: Extract high-quality genomic DNA from T. ferrooxidans strains known to possess mercury resistance, such as strain DSM5083 .

  • DNA fragmentation: Partially digest the genomic DNA with appropriate restriction enzymes. Different restriction enzymes can be used to create complementary libraries:

    • PstI digestion to obtain fragments of approximately 4-12 kb

    • Sau3AI digestion to generate 5-9 kb fragments

  • Vector preparation: Select appropriate cloning vectors compatible with both T. ferrooxidans and E. coli, such as:

    • pBluescriptSK for PstI-digested fragments

    • pUC19 for Sau3AI-digested fragments

  • Ligation and transformation: Ligate the DNA fragments into the prepared vectors and transform into an E. coli host strain. Libraries of over 3,000 clones can be achieved and transferred to microtiter dishes for storage at -80°C .

  • Library screening: Screen the genomic library for the merC gene using:

    • Functional screening for mercury resistance

    • Hybridization with probes derived from known mercury resistance genes, such as those from Tn501

    • PCR-based screening with primers targeting conserved regions of mercury resistance genes

  • Clone verification: Verify positive clones through restriction analysis, DNA sequencing, and functional assays of mercury resistance.

Once isolated, the merC gene can be subcloned into expression vectors for further characterization and functional studies.

What experimental designs are most effective for studying mercuric ion uptake mediated by MerC?

Effective experimental designs for studying MerC-mediated mercuric ion uptake should incorporate these elements:

  • Controlled expression systems: Use inducible promoters, such as the tac promoter, to control MerC expression levels. E. coli cells carrying a plasmid containing the tac promoter-directed merC have shown 203Hg2+ uptake in an IPTG-dependent manner , providing a model system.

  • Randomized block designs: Implement randomized block designs to control for variations in experimental conditions, as recommended in experimental design courses for pre-clinical research . This approach can help identify and isolate factors affecting mercuric ion uptake.

  • Factorial experimental designs: Employ factorial designs to examine the interaction between multiple factors affecting mercury uptake, such as:

    • Temperature

    • pH

    • Mercury concentration

    • Expression level of MerC

    • Presence of other mer operon components

  • Time-course studies: Monitor mercury uptake over time to determine kinetics parameters and establish whether uptake follows saturable or non-saturable patterns.

  • Comparative studies: Compare mercury uptake in:

    • Wild-type versus recombinant strains

    • Different bacterial hosts expressing the same merC construct

    • Strains expressing different variants or mutants of merC

  • Controls: Include appropriate controls such as:

    • Cells with empty vector (no merC)

    • Cells with non-induced merC

    • Cells expressing known mercury transport systems

    • Cells with inhibited energy metabolism to assess energy dependence of transport

This structured approach will help establish causal relationships between MerC expression and mercury uptake while minimizing experimental variability.

How can we validate the functional expression of recombinant merC in T. ferrooxidans?

Validating functional expression of recombinant merC in T. ferrooxidans requires multiple lines of evidence:

  • Genetic confirmation: Verify the presence and correct integration of the merC gene through:

    • PCR analysis with merC-specific primers

    • Southern blot hybridization

    • DNA sequencing to confirm the absence of mutations

  • Transcript analysis: Confirm transcription of the merC gene through:

    • Northern blot analysis

    • RT-PCR

    • RNA-Seq to quantify expression levels relative to housekeeping genes

  • Protein detection: Demonstrate presence of the MerC protein through:

    • Western blot analysis using antibodies against MerC

    • Mass spectrometry analysis of membrane fractions

    • N-terminal amino acid sequencing to verify proper processing (the initiating methionine residue should be removed, as observed in E. coli)

  • Cellular localization: Confirm proper localization of MerC in the membrane fraction through:

    • Cell fractionation and Western blot analysis

    • Immunofluorescence microscopy with labeled antibodies

    • Electron microscopy with immunogold labeling

  • Functional assays: Demonstrate mercury resistance and uptake through:

    • Growth assays in mercury-containing media

    • 203Hg2+ uptake assays

    • Comparison of mercury accumulation in cells with and without merC expression

  • Phenotypic stability: Assess stability of the mercury resistance phenotype through repeated subculturing and testing for maintenance of resistance levels, particularly important given the known phenotypic switching in T. ferrooxidans .

How can contradictions in mercury uptake data be systematically analyzed and resolved?

Systematic analysis of contradictions in mercury uptake data should follow these steps:

  • Formalize contradiction patterns: Apply a notation system using parameters (α, β, θ) as proposed for contradiction representation in health datasets :

    • α: number of interdependent experimental variables

    • β: number of contradictory dependencies identified

    • θ: minimal number of required Boolean rules to assess these contradictions

  • Data quality assessment: Evaluate each dataset for potential sources of error or bias:

    • Experimental design flaws (e.g., inadequate controls, confounding variables)

    • Technical limitations (e.g., detection limits, instrument calibration)

    • Biological variability (e.g., phenotypic switching, strain differences)

    • Data processing errors (e.g., normalization methods, statistical approaches)

  • Contradiction retrieval: Apply specialized approaches like SparseCL that leverage sentence embeddings designed to preserve contradictory nuances between datasets. This approach has demonstrated more than 30% accuracy improvements in identifying contradictions .

  • Statistical reconciliation: Implement appropriate statistical methods:

    • Meta-analysis to integrate findings across multiple studies

    • Sensitivity analysis to identify variables that most strongly influence outcomes

    • Bayesian approaches to update probability estimates as new data becomes available

    • ANOVA to identify significant factors affecting mercury uptake

  • Structured resolution framework: Develop a decision tree for resolving contradictions, prioritizing:

    • Higher quality methodology over lower quality

    • Larger sample sizes over smaller

    • More recent studies over older ones (when methods improve)

    • Studies with fewer potential confounders

This systematic approach can transform contradictions from obstacles into opportunities for deeper understanding of the mechanisms of mercury uptake by MerC.

What statistical approaches are most appropriate for analyzing mercury uptake efficiency in recombinant systems?

The analysis of mercury uptake efficiency in recombinant systems requires sophisticated statistical approaches:

What are the major challenges in developing stable recombinant T. ferrooxidans strains expressing merC?

Developing stable recombinant T. ferrooxidans strains expressing merC presents several significant challenges:

  • Phenotypic instability: T. ferrooxidans exhibits phenotypic switching with high mutation and reversion rates . For example, when a single flat reddish colony was cultured in liquid medium for a week or more and then plated on solid medium, about 5% of the colonies reverted to the wild type . This instability can affect the consistent expression of recombinant genes.

  • Growth medium optimization: T. ferrooxidans requires specialized media for growth and selection of recombinants. The solid 2:2 medium containing both ferrous iron and thiosulfate at pH 4.6-4.8 has proven effective , but maintaining consistent media quality can be challenging.

  • Selective marker limitations: While both antibiotic resistance and heavy metal resistance can serve as selective markers, each has limitations:

    • Some heavy metal-resistance genes might be poorly expressed in T. ferrooxidans

    • T. ferrooxidans strains may adapt physiologically to growth with heavy metals

    • Antibiotic stability in acidic, iron-rich media may be compromised

  • DNA transfer efficiency: The efficiency of DNA transfer into T. ferrooxidans remains a challenge. While the transfer of broad-host-range plasmids has been demonstrated , optimizing protocols for high-efficiency transformation is ongoing.

  • Expression system optimization: Identifying appropriate promoters for stable expression in T. ferrooxidans requires testing various native promoters. A library of TFI70 promoters has been prepared , but characterization of their strength and regulation under different conditions is needed.

  • Verification challenges: Confirming the identity of recombinant T. ferrooxidans can be challenging due to the potential for contamination with other acidophilic bacteria. Southern blot hybridization has been successfully used to establish the identity of variants as derivatives of parental wild-type T. ferrooxidans .

Addressing these challenges requires a systematic approach combining genetic engineering, medium optimization, and rigorous phenotypic and genotypic characterization.

How can mercury toxicity be managed during experiments with recombinant merC expression systems?

Managing mercury toxicity in experimental systems requires careful consideration of safety, experimental design, and data quality:

  • Safety protocols:

    • Use appropriate personal protective equipment (gloves, lab coats, safety glasses)

    • Work in properly ventilated spaces, preferably under fume hoods

    • Implement spill containment and cleanup protocols

    • Adhere to institutional and regulatory guidelines for mercury handling and disposal

  • Concentration optimization:

    • Determine minimum inhibitory concentrations (MICs) of mercury for each strain

    • Use sub-inhibitory concentrations for uptake studies when possible

    • Establish dose-response curves to identify appropriate working concentrations

    • Consider that T. ferrooxidans strains show variable sensitivity to mercury compounds

  • Experimental design considerations:

    • Include proper controls to account for background mercury binding to cell surfaces

    • Use short exposure times when studying uptake to minimize toxicity effects

    • Employ radioisotope tracers (203Hg2+) at lower concentrations when possible

    • Consider using mercury chelators as rescue agents in protocols

  • Alternative approaches:

    • Develop reporter gene systems linked to merC expression

    • Use mercury analogs with lower toxicity when appropriate

    • Consider in silico modeling to complement in vitro experiments

    • Employ cell-free systems for specific mechanistic studies

  • Data quality measures:

    • Monitor cell viability throughout experiments

    • Account for mercury adsorption to experimental apparatus

    • Validate analytical methods for mercury quantification

    • Document all mercury handling procedures in methods sections

By implementing these measures, researchers can effectively study merC function while minimizing risks to personnel and ensuring reliable experimental outcomes.

Bibliography

  • Mercuric Ion Uptake by Escherichia coli Cells Producing Thiobacillus ferrooxidans MerC Protein. (1996). Bioscience, Biotechnology, and Biochemistry, 60(8), 1289-1292.

  • Medical Education Research Certificate (MERC) Program - AAMC. (2004).

  • Xu, H., Lin, Z., Chang, K. W., Sun, Y., & Indyk, P. (2025). Contradiction Retrieval Via Sparse-Aware Sentence Embedding. Submitted to ICLR 2025.

  • FAQ | Methodology and Evaluation Research Core | Nebraska. (2022).

  • DOE/PC/89902 - OSTI.GOV. (1991).

  • Guidelines for Reporting of Figures and Tables for Clinical Research in Urology. (2020).

  • Phenotypic switching of Thiobacillus ferrooxidans - ASM Journals. (1988).

  • MRC DTP Experimental design and Statistics in Pre-clinical Research. (2020).

  • Towards a Consistent Representation of Contradictions Within Health Data Sets. (2023).

  • Methodology and Evaluation Research Core - University of Nebraska-Lincoln. (2025).

  • Solid medium for the genetic manipulation of Thiobacillus ferrooxidans. (1994).

  • MSI MERC Test Plan v2 - Maritime Environmental Resource Center. (2009).

  • Construction and Characterization of a recA Mutant of Thiobacillus ferrooxidans. (2000).

  • Global mercury dataset with predicted methylmercury concentrations in seafood. (2025).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.