Recombinant Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

DsbD is a transmembrane protein with three domains:

  • N-terminal periplasmic domain (nDsbD): Interacts with substrates like DsbC and DsbG .

  • Transmembrane domain (tDsbD): Mediates electron transfer via thiol-disulfide exchange .

  • C-terminal periplasmic domain (cDsbD): Receives electrons from tDsbD and transfers them to nDsbD .

Key Functions:

  • Maintains DsbC/DsbG in reduced states for disulfide isomerization .

  • Supports cytochrome c maturation by reducing apocytochrome disulfides .

  • Protects periplasmic proteins from oxidative damage .

Biochemical Properties

Recombinant DsbD is produced in E. coli or Shigella expression systems with high purity (>85–95%) .

PropertyDetails
Molecular Weight~61 kDa (full-length)
Expression SystemE. coli, Shigella flexneri, or Shigella dysenteriae
Purity≥85% (SDS-PAGE verified)
TagN-terminal His tag (common for purification)
Redox PotentialMaintained by DsbD’s interaction with thioredoxin (Trx)

Mechanism of Action

DsbD operates via a cascade of thiol-disulfide exchange reactions:

  1. Electron Transfer Pathway:

    • Cytoplasmic Trx reduces tDsbD .

    • Electrons flow from tDsbD → cDsbD → nDsbD → substrates (e.g., DsbC, DsbG) .

  2. Redox-Driven Conformational Changes:

    • Reduction of nDsbD disrupts hydrogen bonds, opening its active site for substrate binding .

    • The "Phen cap" loop in nDsbD regulates accessibility to catalytic cysteines .

Kinetic Features:

  • Thiol-disulfide exchange follows an S<sub>N</sub>2 mechanism, requiring linear alignment of reactive thiols .

  • Reaction rates depend on electrostatic interactions and redox potentials .

Domain Architecture:

DomainStructureRole
nDsbDImmunoglobulin-like foldSubstrate recognition and reduction
tDsbDα-helical transmembrane segmentElectron conduit
cDsbDThioredoxin-like foldElectron transfer to nDsbD

Key Residues:

  • Catalytic Cysteines:

    • nDsbD: Cys<sup>103</sup>-Cys<sup>109</sup> (E. coli numbering) .

    • cDsbD: Cys<sup>461</sup>-Cys<sup>464</sup> .

  • Electrostatic Residues: Gln<sup>488</sup> in cDsbD modulates redox potential .

Applications in Research

  1. Protein Folding Studies:

    • Used to elucidate disulfide bond isomerization mechanisms in bacterial virulence factors .

  2. Drug Development:

    • Targeting DsbD disrupts redox homeostasis, impairing pathogen viability (e.g., Neisseria meningitidis) .

  3. Biotechnology:

    • Optimizes recombinant protein production by enhancing disulfide bond accuracy .

Comparative Analysis Across Species

SpeciesUniProt IDKey Features
Escherichia coli K-12P36655Canonical model for DsbD studies
Shigella flexneriQ0SXE390% sequence identity with E. coli DsbD
Shigella dysenteriaeQ328D2Structural conservation in redox-active cysteines

Research Challenges

  • Stability Issues: Oxidized nDsbD is thermodynamically unstable, complicating structural studies .

  • Substrate Specificity: DsbD’s interaction partners (e.g., DsbC vs. DsbG) remain poorly characterized .

Future Directions

  • Structural Dynamics: Time-resolved crystallography to map redox-state transitions .

  • Therapeutic Targeting: Screening inhibitors against DsbD’s thioredoxin-like domains .

Recombinant DsbD serves as a pivotal tool for dissecting bacterial redox biology, with implications for antibiotic development and industrial enzyme engineering. Its conserved mechanism across Gram-negative pathogens underscores its broad relevance in microbiology and biochemistry.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on your location and purchasing method. Please consult your local distributor for specific delivery estimates.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
dsbD; c5218; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-565
Protein Length
Full Length of Mature Protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
dsbD
Target Protein Sequence
GLFDAPGRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNEASQPVSVPQQEQPTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFIMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGTLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLER VIGDIWGLRLWSALGVAFFGWAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGAT HTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKA LADTVLLQANVTANDAQDMALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP
Uniprot No.

Target Background

Function
DsbD is essential for the formation of correct disulfide bonds in certain periplasmic proteins and the assembly of periplasmic c-type cytochromes. It acts by transferring electrons from cytoplasmic thioredoxin to the periplasm. This transfer involves a series of disulfide bond formation and reduction steps.
Database Links

KEGG: ecc:c5218

STRING: 199310.c5218

Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is thiol:disulfide interchange protein DsbD and what is its primary function?

Thiol:disulfide interchange protein DsbD is a bacterial membrane protein that functions as a crucial component in the disulfide bond formation pathway. DsbD provides reducing power to periplasmic enzymes including DsbC, which shuffles incorrect disulfide bonds in misfolded proteins. Additionally, DsbD supplies electrons to enzymes that reduce apo-cytochrome c (CcsX) and to those that repair oxidative protein damages (MrsAB) . This electron transport function makes DsbD essential for proper protein folding and function in the bacterial periplasm. The protein is highly conserved among many bacterial species, particularly in Neisseria spp., where it plays a critical role in bacterial physiology .

How is DsbD organized structurally and what domains contribute to its function?

DsbD is organized into three distinct domains that work together to facilitate electron transfer:

  • N-terminal periplasmic domain (n-DsbD): Contains active cysteine residues that receive electrons from the central domain

  • Central transmembrane domain (t-DsbD): Spans the cytoplasmic membrane

  • C-terminal periplasmic domain (c-DsbD): Contains active site cysteines that transfer electrons to substrate proteins

These domains work in concert to transport electrons from the cytoplasm to periplasmic substrates. The n-DsbD and c-DsbD domains can be studied separately to analyze their redox properties. Research has shown that electron transfer between c-DsbD and n-DsbD can be studied by mixing reduced and oxidized forms and monitoring the thiol-disulfide exchange reaction over time . This domain organization enables the directional flow of reducing equivalents across the membrane to various periplasmic proteins.

What are the most effective approaches for expressing recombinant DsbD in bacterial systems?

For successful expression of recombinant DsbD, researchers have developed optimized protocols using E. coli expression systems targeting periplasmic expression. Key methodological considerations include:

  • Selection of appropriate expression vectors containing periplasmic targeting sequences

  • Optimization of growth conditions: Temperature reduction to 16°C after induction has been shown to improve proper folding

  • IPTG concentration: 250 μM IPTG is commonly used for induction

  • Growth media: LB media for initial growth followed by transfer to minimal media for isotopic labeling

  • Extended expression time (12-14 hours) at reduced temperature after induction

For expression of disulfide-rich proteins like DsbD domains, E. coli strains with enhanced disulfide bond formation capability may be used. This approach has demonstrated a success rate of approximately 75% with various disulfide-rich proteins ranging from 2-8 kDa containing 2-6 disulfide bonds .

How can isotopically-labeled DsbD be produced for structural studies?

Production of isotopically-labeled DsbD for NMR studies employs a dual media approach:

  • Initial growth in LB media: Cultures are grown at 37°C in LB media supplemented with ampicillin (100 μg/mL) with shaking at 180 rpm until OD600 reaches 0.8-1.0

  • Media exchange: Cells are harvested by centrifugation (10 min at 3000g), and the cell pellet is carefully resuspended in M9 minimal media containing labeled compounds

  • M9 minimal media composition:

    • 22 mM KH2PO4

    • 90 mM Na2HPO4

    • 17 mM NaCl

    • 1.6 mM MgSO4

    • 80 nM CaCl2

    • 18 nM NH4Cl or 15NH4Cl (for 15N labeling)

    • 22 mM D-glucose or 13C6-D-glucose (for 13C labeling)

    • 2 μg/mL thiamine

    • 0.002% (v/v) vitamin solution

    • 100 μg/mL ampicillin

  • Recovery period: The culture is returned to 37°C with shaking for 1 hour

  • Induction: Temperature is reduced to 16°C and expression is induced with 250 μM IPTG

  • Harvest: Cells are collected after 12-14 hours by centrifugation (15 min at 7741g)

The volume of M9 media used should be one-fourth of the original LB culture volume (e.g., 500 mL M9 medium for a 2 L LB culture). This approach allows for cost-effective production of labeled protein while maximizing cell density and expression levels.

How does electron transfer occur between DsbD domains and what methods are used to study this process?

Electron transfer between DsbD domains involves a cascade of thiol-disulfide exchange reactions. This process can be studied using the following methodology:

  • Preparation of reduced and oxidized domain forms:

    • Reduced n-DsbD is mixed with oxidized c-DsbD (or vice versa)

    • Reactions are carried out in 100 mM phosphate buffer with 1 mM EDTA at pH 7.0

    • Protein concentrations of 10 μM are typically used

  • Time course analysis:

    • Samples are taken at defined time points (e.g., 15, 120, and 300 seconds)

    • Reactions are quenched by protein precipitation with 10% TCA

    • Precipitated proteins are centrifuged at 16,873 × g

  • Thiol labeling and analysis:

    • Protein pellets are washed with ice-cold 100% acetone

    • Free thiols are labeled with 4-acetamido-4'-maleimidylstilbene-2,2'-disulfonic acid (AMS)

    • Labeled samples are analyzed by SDS-PAGE to separate oxidized and reduced forms

    • Experiments are performed in triplicate to ensure reproducibility

This approach allows for monitoring the kinetics of electron transfer between domains and can be used to assess the effects of mutations or environmental conditions on this process.

What techniques are used to determine the redox potentials of DsbD domains?

Redox potential determination for DsbD domains employs equilibrium with reference redox couples, typically DTT. The methodology involves:

  • Preparation of redox buffers:

    • Domains (typically 2 μM concentration) are incubated in 100 mM phosphate buffer with 1 mM EDTA at pH 7.0

    • Buffer contains 1 mM oxidized DTT and varying concentrations of reduced DTT (10 μM to 100 mM)

    • Incubation occurs at room temperature for 16 hours to reach equilibrium

  • Sample processing:

    • Reactions are stopped by addition of 10% TCA

    • Free thiols are alkylated with AMS (2 mM AMS, 1% SDS, and 50 mM Tris at pH 7.0)

    • Samples are analyzed by SDS-PAGE to separate oxidized and AMS-bound reduced forms

  • Data analysis:

    • The fraction of reduced protein is plotted against the buffer ratio [DTTred]/[DTTox]

    • Equilibrium constants (Keq) are calculated from the plot

    • Redox potentials (E0′) are determined using the Nernst equation

    • Experiments are performed in triplicate to ensure accuracy

This approach provides quantitative information about the thermodynamic properties of the thiol-disulfide exchange reactions catalyzed by DsbD, which is essential for understanding its function in the electron transfer pathway.

How is dsbD expression regulated in bacteria, particularly in Neisseria species?

In Neisseria meningitidis, dsbD expression is uniquely regulated by the MisR/S two-component system, unlike other dsb genes. Key findings about this regulation include:

  • Transcriptional control:

    • qRT-PCR analyses show significantly reduced dsbD expression in misR/S mutants

    • Genetic complementation restores normal expression levels

    • MisR directly and specifically interacts with the upstream region of the dsbD promoter

  • Promoter characterization:

    • A ~70-bp sequence upstream of the transcriptional start site is sufficient for full transcriptional activity

    • Approximately 30-bp of sequence upstream of the dsbD promoter elements is required for MisR regulation

    • DNA fragments containing only the -35 and -10 promoter elements show significantly reduced activity and are not responsive to MisR regulation

  • MisR binding characterization:

    • Electrophoretic mobility shift assays (EMSA) demonstrate specific binding of MisR to the dsbD promoter

    • Competition EMSA confirms binding specificity, as only excess specific DNA fragments eliminate the gel shift

    • DNase I footprinting reveals ~24-bp protected regions on both coding and non-coding strands

Additionally, dsbD expression is induced by reducing agents such as dithiothreitol (DTT), and this induction operates through the MisR/S regulatory system .

What methods are used to construct dsbD mutants for functional studies?

Construction of dsbD mutants for functional analysis typically involves insertional inactivation using antibiotic resistance markers. The methodology includes:

  • Plasmid construction:

    • Plasmid pSLS6 contains an internal fragment of dsbD interrupted with an aadA (Ω) marker encoding spectinomycin resistance

    • Transformation of this plasmid into bacteria results in homologous recombination of the antibiotic resistance cassette into the chromosomal dsbD gene

  • Transformation protocol for Neisseria species:

    • Single colonies are harvested and suspended in transformation broth supplemented with 5% (v/v) DMSO

    • 200-μl aliquot of bacterial suspension is added to 1 μg of plasmid DNA and incubated on ice for 15 min

    • 1 ml of growth broth with supplements is added for recovery

    • Mixture is incubated at 37°C with shaking for 90 min

    • Bacteria are harvested by centrifugation at 3220 × g and plated on selective media

  • Selection and verification:

    • Transformants are selected on media containing appropriate antibiotics

    • Mutants are verified by PCR and/or Southern blot analysis

    • Expression analysis may be performed using RT-PCR or Western blotting

This approach allows for the generation of dsbD null mutants to study the physiological and pathogenic consequences of DsbD deficiency in various bacterial species.

What methods are available to assess DsbD activity in vitro?

Several methods can be employed to assess DsbD activity and the function of its domains in vitro:

  • Fluorescent peptide substrate assay:

    • Purified protein samples (typically 100 nM) are prepared in assay buffer

    • Proteins are mixed with fluorescent peptide substrates (8 μM final concentration)

    • Change in fluorescence is monitored using a plate reader (e.g., Envision Multilabel Plate Reader)

    • Data is presented as mean ± S.E.M. for three biological replicates

  • Thiol-disulfide exchange assays:

    • Reduced and oxidized forms of DsbD domains are mixed

    • Reactions are monitored by quenching at various time points with TCA

    • Free thiols are labeled with AMS and analyzed by SDS-PAGE

    • The relative amounts of oxidized and reduced species are quantified by densitometry

  • Complementation assays:

    • DsbD variants are expressed in dsbD-deficient strains

    • Restoration of phenotypes dependent on DsbD function is assessed

    • Assays may include motility, biofilm formation, or virulence factor production

These methods provide quantitative data on the activity of DsbD and its variants, enabling structure-function analyses and the identification of critical residues or domains.

How do mutations in dsbD affect bacterial physiology and pathogenesis?

Studies on dsbD mutants have revealed several important physiological consequences:

Bacterial SpeciesEffects of dsbD MutationAssociated PhenotypesReference
Neisseria meningitidisAltered protein folding in periplasmReduced virulence, altered outer membrane properties
Neisseria gonorrhoeaeDisrupted disulfide bond formationImpaired type IV pilus function, reduced transformation capability
E. coliCompromised disulfide isomerizationAccumulation of misfolded proteins, stress response activation

Surprisingly, research has revealed that inactivation of dsbD can lead to complex phenotypes beyond simple disruption of disulfide bond formation. The effects are often pleiotropic, affecting multiple cellular processes due to the central role of DsbD in maintaining redox homeostasis in the periplasm .

Functional complementation studies, where wild-type dsbD is reintroduced into mutant strains, can confirm the specificity of observed phenotypes and rule out polar effects on neighboring genes.

What NMR techniques are most suitable for studying the structure and dynamics of DsbD domains?

For structural and dynamic characterization of DsbD domains, several NMR techniques are particularly useful:

  • Heteronuclear NMR for structural determination:

    • Uniformly 15N and 13C labeled samples enable 3D/4D heteronuclear NMR experiments

    • These approaches provide better precision and stereochemical quality compared to homonuclear NMR with unlabeled peptides

    • For peptides <5 kDa, NMR is the dominant approach, with ~80% of structures in this size range being solved using this technique

  • Dynamic properties characterization:

    • 15N relaxation measurements provide information on backbone dynamics

    • Hydrogen-deuterium exchange experiments reveal solvent accessibility and hydrogen bonding networks

    • CPMG and R1ρ experiments can detect conformational exchange processes

  • Redox state monitoring:

    • Chemical shift changes of cysteine residues can track redox state changes

    • Time-resolved NMR can follow the kinetics of thiol-disulfide exchange reactions

The isotopic labeling protocol described earlier enables these advanced NMR studies, providing atomic-level insights into the structure, dynamics, and function of DsbD domains.

What computational approaches enhance understanding of DsbD function and evolution?

Computational methods complement experimental approaches in understanding DsbD:

  • Sequence analysis and evolutionary studies:

    • Multiple sequence alignments reveal conservation patterns across bacterial species

    • Phylogenetic analyses track the evolution of DsbD and related disulfide interchange proteins

    • DsbD is highly prevalent and conserved among Neisseria spp., suggesting its essential role

  • Structural modeling and dynamics:

    • Homology modeling can predict structures of DsbD domains in species where experimental structures are unavailable

    • Molecular dynamics simulations reveal conformational changes during the catalytic cycle

    • Quantum mechanics/molecular mechanics (QM/MM) approaches can model the energetics of thiol-disulfide exchange reactions

  • Systems biology approaches:

    • Network analyses identify proteins dependent on DsbD function

    • Gene co-expression studies reveal conditions under which dsbD is co-regulated with other genes

    • Machine learning methods can predict substrates and interaction partners

These computational approaches provide theoretical frameworks that guide experimental design and help interpret experimental results in the broader context of cellular function.

How can research on DsbD contribute to antimicrobial development strategies?

Research on DsbD has significant implications for antimicrobial development:

  • Target validation:

    • The essentiality of DsbD in certain bacterial species, particularly pathogens like Neisseria meningitidis, makes it a potential drug target

    • Disruption of DsbD function can lead to reduced virulence or viability

  • Inhibitor design approaches:

    • Structure-based drug design targeting the active sites of DsbD domains

    • Peptide mimetics that compete with natural substrates

    • Small molecules that disrupt electron transfer between domains

  • Screening strategies:

    • High-throughput assays based on fluorescent peptide substrates can identify inhibitors

    • Phenotypic screens in dsbD conditional mutants can identify compounds that phenocopy DsbD deficiency

    • Fragment-based approaches to develop lead compounds

Given the increasing problem of antimicrobial resistance, novel targets like DsbD offer promising avenues for developing new classes of antibiotics with mechanisms distinct from conventional drugs.

What are the current technical challenges in DsbD research and emerging solutions?

Several technical challenges persist in DsbD research:

  • Membrane protein expression and purification:

    • Full-length DsbD is challenging to express and purify due to its transmembrane domain

    • Current approaches often focus on individual domains rather than the intact protein

    • Emerging detergent and nanodisk technologies may facilitate full-length protein studies

  • Real-time monitoring of disulfide exchange:

    • Traditional methods involve quenching and ex situ analysis

    • New fluorescent probes and biosensors could enable continuous monitoring in living cells

    • Single-molecule techniques may reveal mechanistic details of electron transfer

  • In vivo relevance:

    • Connecting in vitro biochemical data to in vivo function remains challenging

    • Advanced genetic approaches like CRISPRi for partial knockdown could help determine dosage effects

    • Proteomics approaches to identify the complete set of DsbD-dependent proteins in various bacteria

Addressing these challenges will require interdisciplinary approaches combining structural biology, biochemistry, microbiology, and computational methods to fully understand the complex roles of DsbD in bacterial physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.