Recombinant Thiomicrospira crunogena Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Overview of MsbA

The recombinant Thiomicrospira crunogena Lipid A export ATP-binding/permease protein MsbA (msbA) is a bacterial membrane protein critical for lipid A transport across the cytoplasmic membrane. It belongs to the ATP-binding cassette (ABC) transporter family and functions as a homodimer, utilizing ATP hydrolysis to translocate lipid A, a core component of lipopolysaccharide (LPS), to the outer membrane . This process is essential for the biogenesis of the Gram-negative bacterial outer membrane, which provides structural integrity and defense against environmental stressors .

Key Features of Recombinant MsbA

The recombinant MsbA protein is produced via heterologous expression in Escherichia coli, with modifications to enhance solubility and purification:

ParameterDetails
UniProt IDQ31FG2
SpeciesThiomicrospira crunogena (strain XCL-2)
Expression SystemE. coli
TagN-terminal His tag (for affinity chromatography)
Protein LengthFull-length (1–581 amino acids)
Purity>90% (SDS-PAGE-verified)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionLyophilized powder; reconstitute in deionized water (0.1–1.0 mg/mL)
StabilityAliquot and store at -20°C/-80°C; avoid freeze-thaw cycles .

ATP-Dependent Lipid Flippase Activity

MsbA exhibits ATP-dependent lipid translocation, critical for flipping lipid A from the inner to the outer leaflet of the cytoplasmic membrane. Key findings include:

  • Maximal Activity: 7.7 nmol lipid translocated per mg protein over 20 minutes using NBD-labeled phosphatidylethanolamine (PE) .

  • Substrate Specificity: Binds lipid A with low micromolar affinity (Kd ~1–10 µM) and translocates diverse NBD-labeled lipids, including phospholipids and glycolipids .

  • Inhibition: Lipid A competitively inhibits NBD-PE translocation, confirming it as the physiological substrate .

Interaction with Amphipathic Molecules

MsbA binds amphipathic drugs (e.g., daunorubicin) and lipid A simultaneously, suggesting distinct binding sites. Nucleotide and substrate binding modulate each other’s affinities, indicating allosteric communication within the protein .

Antibiotic Target Potential

MsbA is a validated target for novel antimicrobials, as its inhibition disrupts LPS synthesis and outer membrane biogenesis:

  • Quinoline Inhibitors: Identified compounds selectively inhibit MsbA’s ATPase and transport activity, demonstrating efficacy against multidrug-resistant E. coli strains .

  • Mechanism: Inhibition prevents lipid A export, destabilizing the outer membrane and inducing bacterial cell death .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your desired format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; Tcr_1519; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-581
Protein Length
full length protein
Species
Hydrogenovibrio crunogenus (strain XCL-2) (Thiomicrospira crunogena)
Target Names
msbA
Target Protein Sequence
MFDRHTLSLYKRLLKYISGYKSAIFITLITIAIIAATEPLSAIILGNLVDESLIEKDPNS FLLLPLQLAAVFIVKGVAEYFSKVMSTWIAQKAIFNIRSELYDKMLCLPQAEHNQTSTGT LMSKVTYDVTQTGNALSEAWIVIARDSLTILALLATLIYYSWQLTLVMLIIGPIVAFFID RAGKLMRTSSTDMQDNMGEMTHRLEEGLKGYQDIKIYGSEKYELDRFKASAESLRQNTMK VIKVSALNVPLVQVIAAIALSIVVYIAVQMVNAETMTAGNLITYVTAMGLIFEPIRRITN INATVQRGMAAAKSIFAILDTPSEANNGKIELSNVNGQIDFNNVSFSYLGTEKTALNNFS LSIPARKTTALVGQSGSGKTTLANLITRFYQVNHGTITIDGIALDEIELNNLRANIAFVS QNVVLFNDTIAANIAYGHEEYDEQAIMNAAKAAHAWEFIEKLPEGLNTIIGDNGTLLSGG QRQRLAIARAFLKNAPILIMDEATSALDNQSEKLIQEAMNSLRKNRTVIIIAHRLSTIEN ADKIVVLEEGSLKEQGTHAELMALNSIYSQLYKQGNLSEQV
Uniprot No.

Target Background

Function
This protein plays a crucial role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Thiomicrospira crunogena and what ecological niche does it occupy?

Thiomicrospira crunogena is a colorless, sulfur-oxidizing bacterium isolated from the 21°N deep-sea (2,600-m) hydrothermal vent area of the East Pacific Rise . This organism is an obligate chemolithoautotrophic sulfur oxidizer, meaning it derives energy from the oxidation of inorganic sulfur compounds and uses carbon dioxide as its sole carbon source. It has adapted to the extreme conditions of deep-sea hydrothermal vents, where it contributes to local biogeochemical cycling.

The bacterium has evolved specialized mechanisms for carbon acquisition in its low dissolved inorganic carbon (DIC) environment, including a CO₂ concentrating mechanism (CCM) that actively transports DIC across the cell membrane to facilitate carbon fixation . This adaptation is particularly significant given the challenging conditions of its deep-sea habitat.

What is the MsbA protein and what is its general function in gram-negative bacteria?

MsbA is an essential ATP-binding cassette (ABC) transporter found in gram-negative bacteria. Its primary function is to transport lipid A and lipopolysaccharide (LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . This transport mechanism is critical for the biogenesis of the outer membrane, which serves as an essential protective barrier.

As an ABC transporter, MsbA utilizes energy from ATP hydrolysis to drive conformational changes that facilitate the translocation of these complex lipid molecules across the membrane. The protein operates through a series of conformational states, binding ATP at the nucleotide-binding domains (NBDs) and using this energy to power the "flipping" of lipid substrates through its transmembrane domains .

What expression systems are suitable for recombinant T. crunogena MsbA production?

Based on the available information, recombinant T. crunogena MsbA has been successfully expressed in E. coli with an N-terminal His-tag . This suggests that bacterial expression systems, particularly E. coli, are suitable hosts for heterologous production of this membrane protein.

For researchers attempting expression, several methodological considerations should be addressed:

  • Vector selection: Vectors with tightly controlled, inducible promoters (such as T7 or tac) are generally preferred for membrane protein expression

  • Host strain optimization: E. coli strains optimized for membrane protein expression (such as C41/C43, Lemo21, or Rosetta strains) may improve yield and quality

  • Expression conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often favor proper folding of membrane proteins

  • Addition of specific chaperones or folding modulators may improve expression outcomes

Researchers should empirically optimize these parameters for their specific experimental requirements, monitoring both quantity and quality of the expressed protein.

What are the recommended purification strategies for obtaining high-quality T. crunogena MsbA protein?

The recombinant T. crunogena MsbA described in the search results includes an N-terminal His-tag, enabling affinity chromatography-based purification . A comprehensive purification workflow for this membrane protein would include:

  • Cell disruption: Carefully optimize lysis conditions to solubilize membrane fractions while maintaining protein integrity

  • Membrane isolation: Separate membrane fractions by differential centrifugation

  • Detergent solubilization: Select appropriate detergents for MsbA solubilization (common choices include DDM, LMNG, or facial amphiphiles as mentioned in search result )

  • Affinity purification: Utilize immobilized metal affinity chromatography (IMAC) with Ni-NTA or cobalt resins to capture the His-tagged protein

  • Size exclusion chromatography: Further purify and assess the homogeneity of the protein preparation

  • Quality assessment: Verify purity by SDS-PAGE (>90% purity is achievable ) and functionality through activity assays

The search results indicate the purified protein can be provided as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

What are the critical considerations for maintaining stability and activity of purified T. crunogena MsbA?

Membrane proteins like MsbA require special handling to maintain their native structure and function. Based on the available information, researchers should consider:

  • Storage conditions:

    • Store lyophilized protein at -20°C/-80°C

    • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Centrifuge vials briefly before opening to collect contents at the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (with 50% being recommended) for long-term storage at -20°C/-80°C

  • Buffer composition considerations:

    • Maintain appropriate pH (pH 8.0 is used in the referenced preparation)

    • Include stabilizing agents (e.g., trehalose at 6% concentration)

    • Consider detergent critical micelle concentration and stability

These precautions help preserve the structural and functional integrity of the MsbA protein for downstream experimental applications.

What methods can be employed to assess the ATPase activity of T. crunogena MsbA?

As an ABC transporter, MsbA's function depends on ATP binding and hydrolysis. While the search results don't specifically describe assays for T. crunogena MsbA, several established methodologies can be adapted:

  • Colorimetric phosphate release assays:

    • Malachite green-based detection of released inorganic phosphate

    • Molybdate-based colorimetric quantification

    • These assays should be optimized for detergent compatibility

  • Coupled enzyme assays:

    • ATP hydrolysis coupled to NADH oxidation via pyruvate kinase and lactate dehydrogenase

    • Continuous monitoring of NADH absorbance at 340 nm

    • Correction for background ATPase activity is essential

  • ATPase activity modulators:

    • Test lipid A or LPS as potential activity stimulators

    • Evaluate the effects of known ABC transporter inhibitors

    • Investigate temperature and pH dependence to identify optimal conditions

  • Data analysis parameters:

    • Calculate specific activity (μmol ATP hydrolyzed/min/mg protein)

    • Determine kinetic parameters (Km for ATP, Vmax)

    • Compare activity under varying environmental conditions relevant to deep-sea hydrothermal vents

These approaches provide complementary information about the catalytic properties of T. crunogena MsbA and can help establish structure-function relationships.

How can researchers investigate the lipid A transport function of T. crunogena MsbA?

Assessing the transport function of MsbA requires specialized techniques that probe its ability to translocate lipid substrates across membranes:

  • Reconstitution systems:

    • Incorporation into proteoliposomes with defined lipid composition

    • Nanodisc reconstitution for single-molecule studies

    • Lipid bilayer electrophysiology for transport-associated currents

  • Transport assay approaches:

    • Fluorescently labeled lipid A analogs to track translocation

    • Inside-out vesicle preparations to study directional transport

    • Accessibility assays using membrane-impermeable probes

  • Binding studies:

    • Isothermal titration calorimetry to measure substrate binding thermodynamics

    • Fluorescence-based binding assays using environment-sensitive probes

    • Competition assays to determine substrate specificity

The transport mechanism insights from S. typhimurium MsbA, which revealed a "trap and flip" model with electron density for lipid A inside the transmembrane cavity and near the periplasmic exit site , provide conceptual frameworks for designing similar experiments with the T. crunogena protein.

What techniques are available for studying the conformational dynamics of T. crunogena MsbA?

ABC transporters undergo substantial conformational changes during their transport cycle. Several biophysical techniques can illuminate these dynamics:

  • Structural approaches:

    • X-ray crystallography to capture distinct conformational states, as demonstrated for S. typhimurium MsbA at 2.8 Å resolution

    • Cryo-electron microscopy for visualizing conformational ensembles, potentially revealing states with large NBD separation or intermediate conformations

    • Hydrogen-deuterium exchange mass spectrometry to identify regions with altered solvent accessibility

  • Spectroscopic methods:

    • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) to measure distances between domains

    • Fluorescence resonance energy transfer (FRET) using strategically placed fluorophores to monitor domain movements

    • Intrinsic tryptophan fluorescence to detect substrate-induced conformational changes

  • Computational approaches:

    • Molecular dynamics simulations to predict conformational transitions and substrate pathways

    • Normal mode analysis to identify intrinsic protein motions

    • Targeted molecular dynamics to explore transition pathways between known conformational states

These complementary approaches can reveal how T. crunogena MsbA cycles through different conformations during lipid A transport and how these dynamics might be adapted to the extremophilic lifestyle of this organism.

What insights have been gained from structural studies of MsbA proteins and how might they apply to T. crunogena MsbA?

Structural studies of MsbA homologs, particularly from S. typhimurium, have provided significant insights into the lipid A transport mechanism:

  • Key conformational states:

    • Inward-facing conformation with a large transmembrane portal opening, allowing lipid A access from the cytoplasmic leaflet

    • Intermediate conformations with varying degrees of NBD separation

    • Outward-facing conformation that facilitates lipid A release to the periplasmic leaflet

  • Substrate binding evidence:

    • Electron density attributed to lipid A observed inside the transmembrane cavity, supporting a "trap and flip" model

    • Additional density near an outer surface cleft at the periplasmic ends of the transmembrane helices, suggesting a potential post-transport docking site

  • Functional implications:

    • The conformational cycle appears to involve progressive closure of the NBDs upon ATP binding

    • Large conformational changes are required for substrate transport

    • Multiple substrate interaction sites may exist along the transport pathway

These structural insights provide testable hypotheses about T. crunogena MsbA function and could guide experimental design for structure-function studies specific to this extremophilic variant.

How does T. crunogena MsbA compare to homologs from other extremophilic bacteria?

While the search results don't provide direct comparisons between T. crunogena MsbA and other extremophilic homologs, this represents an important research direction. Comparative analysis could reveal:

  • Sequence adaptations:

    • Amino acid composition differences that might confer stability under high pressure

    • Modified flexibility in key regions to maintain function at extremes of temperature

    • Altered surface charge distribution to accommodate the ionic conditions of hydrothermal vents

  • Structural adaptations:

    • Potential reinforcement of intramolecular interactions in regions critical for conformational changes

    • Modified substrate binding pockets that might accommodate variations in lipid A structure

    • Adaptations in ATP binding and hydrolysis machinery for function under extreme conditions

  • Functional consequences:

    • Altered kinetic parameters compared to mesophilic homologs

    • Modified substrate specificity or transport efficiency

    • Different responses to environmental stressors

This comparative approach would contribute to our broader understanding of protein adaptation to extreme environments and could reveal novel biotechnological applications for extremophilic membrane transporters.

What can be learned by comparing the regulation of MsbA with other transporters in T. crunogena?

T. crunogena has evolved specialized transport systems for survival in its unique ecological niche. Comparative analysis of MsbA regulation with other transporters could reveal:

  • Environmental response patterns:

    • While not specific to MsbA, the search results show that T. crunogena upregulates certain transporters (like the DIC transport system) under specific limitation conditions, with genes Tcr_0853 and Tcr_0854 showing 263- and 340-fold increases, respectively, under DIC limitation

    • This suggests sophisticated regulatory networks that might also apply to MsbA

  • Regulatory mechanisms:

    • Transcriptional regulation in response to environmental signals

    • Post-translational modifications that modulate transport activity

    • Co-regulation of transporters involved in related cellular processes

  • Experimental approaches:

    • RNA-seq or qPCR to measure expression levels under varying conditions

    • Promoter analysis to identify regulatory elements

    • Comparison of expression patterns across different transport systems

Understanding these regulatory patterns could provide insights into how T. crunogena coordinates its membrane transport processes to thrive in the challenging environment of deep-sea hydrothermal vents.

How can site-directed mutagenesis be employed to investigate critical functional residues in T. crunogena MsbA?

Site-directed mutagenesis represents a powerful approach for identifying functionally important residues in MsbA. Based on established methodologies for T. crunogena genetic manipulation , researchers could:

  • Target selection strategies:

    • Conserved motifs including Walker A/B and signature motifs in the NBDs

    • Residues lining the proposed lipid A binding pocket

    • Regions implicated in conformational coupling between domains

    • Unique residues that differentiate T. crunogena MsbA from mesophilic homologs

  • Mutagenesis methods:

    • PCR-based site-directed mutagenesis

    • Transposon-based mutagenesis approaches similar to those described for other T. crunogena genes

    • CRISPR-Cas9 based methods if applicable to this organism

  • Functional assessment:

    • Expression and purification of mutant proteins

    • Comparative ATPase activity measurements

    • Transport assays with reconstituted systems

    • Complementation studies in MsbA-deficient strains

  • Result interpretation frameworks:

    • Conservative substitutions to probe specific chemical properties

    • Radical substitutions to disrupt function

    • Structure-guided interpretation of functional effects

This systematic approach can provide detailed molecular insights into how T. crunogena MsbA accomplishes lipid A transport under extreme environmental conditions.

What are effective approaches for studying the interaction between T. crunogena MsbA and lipid A?

Understanding the interaction between MsbA and its substrate lipid A requires specialized methodologies:

  • Direct binding assessment:

    • Surface plasmon resonance to measure binding kinetics

    • Microscale thermophoresis for solution-based binding studies

    • Isothermal titration calorimetry to determine thermodynamic parameters

  • Structural approaches:

    • Co-crystallization with lipid A or analogs

    • Cryo-EM of MsbA-lipid A complexes

    • Hydrogen-deuterium exchange mass spectrometry to identify regions with altered solvent accessibility upon lipid A binding

  • Computational methods:

    • Molecular docking to predict binding modes

    • Molecular dynamics simulations to explore substrate access pathways

    • Binding free energy calculations to compare different substrates

  • Biochemical mapping techniques:

    • Photocrosslinking with modified lipid A analogs

    • Chemical crosslinking combined with mass spectrometry

    • Accessibility scanning mutagenesis to delineate the substrate binding pocket

These approaches can reveal how T. crunogena MsbA recognizes and transports its lipid A substrate, potentially identifying unique features related to its extremophilic lifestyle.

How can researchers investigate potential inhibitors of T. crunogena MsbA and their mechanisms of action?

While primarily of academic interest for this non-pathogenic organism, inhibitor studies can provide valuable insights into MsbA function:

  • Inhibitor identification strategies:

    • Structure-based virtual screening targeting the ATP binding site or substrate binding pocket

    • Repurposing known inhibitors of homologous ABC transporters

    • Fragment-based screening approaches

    • Natural product libraries focused on marine-derived compounds

  • Inhibition mechanism characterization:

    • ATPase activity assays in the presence of inhibitors

    • Conformational state analysis to determine if inhibitors lock the protein in specific conformations

    • Competition assays with ATP or lipid A to identify binding site overlap

  • Structure-activity relationship development:

    • Synthesis of analog series to identify key pharmacophore features

    • Co-crystallization or cryo-EM studies with bound inhibitors

    • Computational modeling to predict binding modes and guide optimization

  • Comparative inhibition profiles:

    • Testing inhibitors against MsbA from pathogenic bacteria to identify selectivity determinants

    • Comparing inhibition patterns between extremophilic and mesophilic homologs

The search results mention that a small molecule antagonist shifted MsbA to an inactive state not competent for ATP hydrolysis , demonstrating the feasibility of inhibitor development for this class of transporters.

How might the environmental conditions of deep-sea hydrothermal vents influence the evolution of T. crunogena MsbA?

T. crunogena's habitat at deep-sea hydrothermal vents presents unique selective pressures that likely influenced MsbA evolution:

  • High-pressure adaptations:

    • Potential structural modifications to maintain conformational flexibility under pressure

    • Altered lipid-protein interactions to accommodate membrane effects of high pressure

    • Modified ATP binding and hydrolysis mechanisms optimized for high-pressure environments

  • Temperature adaptation considerations:

    • Thermal stability features to withstand temperature fluctuations near vents

    • Potential cold-adaptation features for functioning in the generally cold deep-sea environment

    • Structural elements that provide stability across a broad temperature range

  • Chemical environment effects:

    • Adaptations to function in the presence of high sulfide concentrations

    • Resistance to heavy metals and other potentially toxic compounds found at hydrothermal vents

    • Modifications to accommodate the unique lipid composition that may have evolved in this organism

  • Carbon acquisition relationship:

    • Potential co-evolution with the CO₂ concentrating mechanism (CCM) described in search result

    • Coordination with other transport systems critical for chemolithoautotrophic lifestyle

Comparative genomic and structural studies between T. crunogena MsbA and homologs from different environments could illuminate these evolutionary adaptations.

What can we learn about bacterial adaptation from studying transporters like MsbA in extremophiles?

Extremophilic transporters like T. crunogena MsbA offer valuable insights into bacterial adaptation:

  • Molecular adaptation principles:

    • Identification of conserved versus variable regions under selective pressure

    • Understanding how essential functions are maintained under extreme conditions

    • Revealing the balance between structural stability and functional flexibility

  • Membrane biology insights:

    • How lipid-protein interactions are modified in extremophiles

    • Adaptations in membrane transport mechanisms for extreme environments

    • Co-evolution of membrane composition and membrane protein function

  • Evolutionary implications:

    • Convergent versus divergent evolution in transporters from different extremophiles

    • Identification of environmental condition-specific adaptation signatures

    • Understanding the limits of protein adaptation to extreme conditions

  • Biotechnological applications:

    • Engineering robustness into membrane proteins for biotechnological applications

    • Identifying structural elements that confer stability under harsh conditions

    • Developing extremophile-derived systems for industrial processes

These insights extend beyond T. crunogena to inform our broader understanding of how life adapts to extreme environments.

What emerging technologies might advance our understanding of T. crunogena MsbA structure and function?

Several cutting-edge technologies hold promise for deepening our understanding of this transporter:

  • Advanced structural methods:

    • Time-resolved cryo-EM to capture transient conformational states during the transport cycle

    • Micro-electron diffraction (MicroED) for structural determination from small crystals

    • Integrative structural biology approaches combining multiple experimental data types

  • Single-molecule techniques:

    • High-speed atomic force microscopy to visualize conformational dynamics in real-time

    • Single-molecule FRET to track conformational changes during substrate transport

    • Optical tweezers to measure forces associated with conformational transitions

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes with bound lipids and nucleotides

    • Identification of post-translational modifications and their functional significance

    • Characterization of protein-lipid interactions specific to extremophilic adaptation

  • In situ techniques:

    • Cryo-electron tomography of T. crunogena cells to visualize MsbA in its native membrane environment

    • Correlative light and electron microscopy to track MsbA distribution and dynamics

    • Development of genetic tools for in vivo studies specific to T. crunogena

These technologies could overcome current limitations in studying membrane transporters from extremophilic organisms and provide unprecedented insights into their structure-function relationships.

How might research on T. crunogena MsbA contribute to biotechnological applications?

The unique properties of this extremophilic transporter could be valuable for various applications:

  • Protein engineering platforms:

    • Development of pressure-stable membrane protein scaffolds

    • Creation of robust lipid-flipping enzymes for biotechnology

    • Engineering transporters with enhanced stability for industrial processes

  • Drug delivery systems:

    • Design of lipid transport systems inspired by MsbA for pharmaceutical applications

    • Development of nanoscale lipid transport devices for targeted delivery

    • Creation of stable lipid nanostructures for extreme environments

  • Bioremediation applications:

    • Engineered microorganisms with enhanced membrane integrity for toxic environments

    • Development of biosensors based on MsbA conformational changes

    • Creation of synthetic biology systems for extreme environment remediation

  • Fundamental research tools:

    • Stable expression systems for difficult membrane proteins

    • Model systems for studying membrane transport under extreme conditions

    • Development of extremophilic cell-free protein synthesis platforms

These applications leverage the natural adaptations of T. crunogena MsbA to extreme conditions while addressing current challenges in biotechnology and pharmaceutical development.

What interdisciplinary approaches could enhance our knowledge of extremophilic membrane transporters like T. crunogena MsbA?

Addressing the complexity of extremophilic membrane transporters requires integrative approaches:

  • Computational-experimental integration:

    • Molecular dynamics simulations under simulated extreme conditions validated by experimental data

    • Machine learning approaches to identify adaptation patterns across extremophilic transporters

    • Quantum mechanical calculations to understand electronic aspects of catalysis under extreme conditions

  • Evolutionary biology perspectives:

    • Comparative genomics across extremophiles from different lineages

    • Ancestral sequence reconstruction to trace the evolution of extremophilic adaptations

    • Experimental evolution studies to observe adaptation in real-time

  • Systems biology frameworks:

    • Multi-omics integration to understand MsbA in the context of global cellular adaptation

    • Metabolic modeling to quantify the energetic impact of membrane transport

    • Network analysis to identify co-regulated processes across extreme conditions

  • Astrobiology connections:

    • Insights into potential membrane adaptations for life in extreme extraterrestrial environments

    • Understanding the limits of membrane protein function for habitability assessment

    • Development of biosignatures based on membrane lipid transport mechanisms

These interdisciplinary approaches could reveal new dimensions of membrane transporter adaptation to extreme environments and uncover principles applicable across biological and technological domains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.