Recombinant Thylamys elegans NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Production and Handling

Commercial recombinant Thylamys elegans MT-ND4L is typically supplied as a purified protein with >85% purity (SDS-PAGE) . Key handling considerations include:

  • Purity: >85% (SDS-PAGE) .

  • Reconstitution: Use deionized sterile water to 0.1–1.0 mg/mL, with 5–50% glycerol for stability .

  • Stability: Lyophilized forms last 12 months at -20°C/-80°C; liquid forms have a 6-month shelf life .

Comparative Analysis with Other Species

Recombinant MT-ND4L proteins from various organisms exhibit conserved structural and functional features. Below is a comparative overview:

SpeciesUniprot IDExpression SystemKey ApplicationsSources
Thylamys elegans (Opossum)Q70XG4E. coli (inferred)ELISA, structural studies
Phoca vitulina (Seal)P68310E. coliFunctional assays, comparative modeling
Oncorhynchus clarkii (Trout)P69306YeastProtein interaction studies
Homo sapiens (Human)P03901YeastDiagnostic kits, disease modeling

Clinical and Functional Relevance

MT-ND4L is integral to Complex I’s role in oxidative phosphorylation, facilitating NADH-to-ubiquinone electron transfer and proton pumping . Dysfunctional MT-ND4L variants are implicated in metabolic disorders (e.g., obesity, diabetes) and mitochondrial diseases like LHON . While Thylamys elegans MT-ND4L is not directly linked to human diseases, its study contributes to understanding evolutionary conserved mechanisms of Complex I dysfunction.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We select the tag type during the production process. If you have a specific tag type requirement, please inform us. We will prioritize development of your specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Thylamys elegans (Elegant fat-tailed mouse opossum)
Target Names
Target Protein Sequence
MASINLNIIMAFIMALMGVLIYRSHLMSTLLCLEGMMLSLFILVTLLISQSHMLTTSMMP LILLVFSACEAGVGLALLVTISTTYGNDHVQNLNLLQC
Uniprot No.

Target Background

Function
This protein serves as the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, employing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental structure and function of MT-ND4L?

MT-ND4L is a mitochondrially encoded gene producing an 11 kDa protein composed of 98 amino acids. The protein functions as a core subunit of NADH dehydrogenase (ubiquinone), also known as Complex I, which is located in the mitochondrial inner membrane and represents the largest of the five complexes in the electron transport chain. MT-ND4L is predominantly hydrophobic and forms part of the transmembrane region of Complex I, contributing to the first step in electron transport—the transfer of electrons from NADH to ubiquinone during oxidative phosphorylation .

What unique genomic features characterize the MT-ND4L gene?

A distinctive feature of the human MT-ND4L gene is its 7-nucleotide overlap with the MT-ND4 gene. Specifically, the last three codons of MT-ND4L (5'-CAA TGC TAA-3' coding for Gln, Cys, and Stop) overlap with the first three codons of MT-ND4 (5'-ATG CTA AAA-3' coding for Met-Leu-Lys). With respect to the MT-ND4L reading frame (+1), the MT-ND4 gene starts in the +3 reading frame. This unusual arrangement reflects the compact organization of the mitochondrial genome and may have implications for coordinated expression of these functionally related proteins .

What are the optimal storage and handling conditions for recombinant MT-ND4L proteins?

Recombinant Thylamys elegans MT-ND4L should be stored at -20°C for regular use, or at -80°C for extended storage periods. For working aliquots, storage at 4°C is suitable for up to one week. The protein is typically supplied in a Tris-based buffer with 50% glycerol optimized for protein stability. Repeated freeze-thaw cycles should be avoided to maintain protein integrity. For human recombinant MT-ND4L variants, storage in PBS with 1M Urea at pH 7.4 has been documented to maintain stability .

What experimental methods are most effective for studying MT-ND4L interactions with other Complex I subunits?

When investigating MT-ND4L interactions with other Complex I components, a combination of approaches is recommended:

  • Cross-linking coupled with mass spectrometry: This allows identification of interaction interfaces between MT-ND4L and neighboring subunits

  • Blue native PAGE: For analyzing intact Complex I assembly and stability

  • Co-immunoprecipitation: Using antibodies against MT-ND4L or other Complex I subunits

  • FRET (Förster Resonance Energy Transfer): For examining dynamic interactions in intact mitochondria

These methods should be complemented with appropriate controls, including recombinant proteins with tag-only constructs to account for non-specific interactions .

How can researchers effectively validate antibodies targeting MT-ND4L in experimental systems?

Antibody validation for MT-ND4L requires a multi-step approach:

  • Competition assays: Using recombinant MT-ND4L protein antigen to demonstrate specific binding. The recombinant protein should be used as a blocking agent to confirm antibody specificity.

  • Western blotting: On mitochondrial fractions compared with whole cell lysates to confirm appropriate molecular weight and subcellular localization

  • Immunocytochemistry: To verify mitochondrial localization with co-staining using established mitochondrial markers

  • siRNA knockdown or CRISPR-Cas9 modification: To validate signal reduction in cells with diminished MT-ND4L expression

  • Positive controls: Using tissues known to have high mitochondrial content, such as heart or liver samples

What structural features distinguish Thylamys elegans MT-ND4L from human MT-ND4L?

While both Thylamys elegans and human MT-ND4L proteins share core functional domains related to their role in Complex I, comparative sequence analysis reveals distinct differences that may influence protein folding and interaction with neighboring subunits. The Thylamys elegans MT-ND4L contains regions with the amino acid sequence "MLFILVTLLISQSHMLTTSMMP LILLVFSACEAGVGLALLVTISTTYGNDHVQNLNLLQC" that contribute to its transmembrane domains. The human equivalent demonstrates conservation in hydrophobic regions essential for membrane insertion, but with species-specific variations that may affect the precise positioning within the complex and potentially influence electron transport efficiency .

How do mutations in MT-ND4L affect Complex I assembly and function?

Mutations in MT-ND4L can disrupt Complex I assembly and function through several mechanisms:

  • Structural destabilization: Alterations in hydrophobic regions can compromise membrane insertion and complex stability

  • Proton pumping efficiency: Mutations may affect conformational changes required for proton translocation

  • Electron transfer kinetics: Amino acid substitutions can alter the redox environment, impacting electron flow

  • Supercomplex formation: Changes may disrupt interactions with other respiratory chain complexes

The T10663C (Val65Ala) mutation associated with Leber's Hereditary Optic Neuropathy exemplifies how a seemingly conservative substitution can significantly impact Complex I function, potentially through subtle changes in protein-protein interactions or membrane positioning .

What biophysical techniques are most informative for analyzing MT-ND4L structural dynamics?

For analyzing MT-ND4L structural dynamics within Complex I, researchers should consider:

  • Cryo-electron microscopy: Provides high-resolution structural information of MT-ND4L in the context of assembled Complex I

  • Hydrogen-deuterium exchange mass spectrometry: Reveals solvent-accessible regions and conformational changes

  • Site-directed spin labeling with EPR spectroscopy: Measures distances between specific residues during functional states

  • Molecular dynamics simulations: Offers insights into protein motion and lipid interactions within the membrane environment

  • Single-molecule FRET: Captures dynamic conformational changes during catalytic cycles

These techniques, when used complementarily, can elucidate how MT-ND4L contributes to the conformational changes associated with electron transfer and proton pumping .

What is the evidence linking MT-ND4L variants to Alzheimer's disease?

Recent whole exome sequencing analysis from the Alzheimer's Disease Sequencing Project (ADSP) involving 10,831 participants revealed a study-wide significant association between Alzheimer's disease (AD) and a rare MT-ND4L variant (rs28709356 C>T) with a minor allele frequency of 0.002 (P = 7.3 × 10^-5). Additionally, gene-based testing showed significant association of MT-ND4L with AD (P = 6.71 × 10^-5). These findings suggest MT-ND4L may play a role in AD pathogenesis, potentially through mechanisms involving mitochondrial dysfunction, oxidative stress, and energy metabolism disruption in neural tissues .

How does the Val65Ala mutation in MT-ND4L contribute to Leber hereditary optic neuropathy?

The T10663C (Val65Ala) mutation in MT-ND4L has been identified in several families with Leber hereditary optic neuropathy (LHON). This mutation replaces the amino acid valine with alanine at position 65 of the protein. While the exact pathogenic mechanism remains under investigation, current evidence suggests that this substitution may:

  • Alter the hydrophobicity profile of a critical transmembrane domain

  • Affect interactions with other Complex I subunits

  • Compromise electron transfer efficiency

  • Increase reactive oxygen species production

  • Lead to energy deficiency in retinal ganglion cells with high metabolic demands

These mechanisms collectively contribute to the selective vulnerability of optic nerve fibers characteristic of LHON .

What experimental models best replicate the pathological effects of MT-ND4L mutations?

To investigate MT-ND4L-related pathologies, researchers should consider:

  • Cybrid cell models: Transferring mitochondria from patient cells into mtDNA-depleted recipient cells

  • Patient-derived fibroblasts: For direct assessment of mitochondrial function

  • iPSC-derived neurons and retinal ganglion cells: For tissue-specific effects in relevant cell types

  • CRISPR-engineered cellular models: For introducing specific mutations into control cells

  • Mouse models with humanized mitochondrial genomes: For in vivo studies of pathophysiology

Each model offers distinct advantages, with cybrids allowing isolation of mitochondrial effects, while iPSC-derived models provide cell type-specific insights particularly valuable for understanding tissue-selective pathologies like LHON .

How does the evolutionary conservation of MT-ND4L inform our understanding of its critical functional domains?

Evolutionary analysis of MT-ND4L across species reveals highly conserved regions that likely represent critical functional domains essential for Complex I activity. Alignment studies demonstrate that the transmembrane helical regions show the highest conservation, while loop regions exhibit greater variability. This pattern suggests that maintaining precise membrane topology is crucial for function. Residues involved in proton pumping pathways and those forming interfaces with other core subunits show particularly strong conservation. The evolutionary data provides researchers with targets for functional studies, as mutations in highly conserved residues are more likely to disrupt enzyme activity and potentially cause disease .

What can comparative studies of Thylamys elegans MT-ND4L teach us about mitochondrial adaptations to metabolic demands?

Thylamys elegans, as a marsupial species with distinct metabolic adaptations, offers unique insights into the evolution of mitochondrial function. Comparative studies of MT-ND4L between Thylamys elegans and other mammals can reveal:

  • Adaptations related to energy metabolism in different ecological niches

  • Structural modifications that might enhance Complex I efficiency under specific metabolic conditions

  • Species-specific regulatory mechanisms affecting mitochondrial gene expression

  • Coevolution patterns with nuclear-encoded Complex I subunits

Such comparative approaches can illuminate how variations in MT-ND4L sequence might contribute to differences in metabolic efficiency, ROS production, and adaptations to environmental stressors across species .

How do post-translational modifications of MT-ND4L differ across species and what are their functional implications?

Post-translational modifications (PTMs) of MT-ND4L represent an important but understudied aspect of Complex I regulation. Comparative proteomic analyses suggest species-specific patterns of PTMs that may include:

  • Phosphorylation sites that regulate Complex I assembly or activity

  • Acetylation patterns that respond to metabolic state

  • Oxidative modifications that occur during cellular stress

  • Lipid modifications that facilitate membrane integration

The functional implications of these modifications likely include adaptation to different metabolic demands, response to cellular stress, and fine-tuning of electron transport efficiency. Methodologically, studying these PTMs requires techniques such as targeted mass spectrometry, PTM-specific antibodies, and functional assays comparing wild-type and modification-site mutants .

What strategies can overcome the challenges of expressing and purifying highly hydrophobic MT-ND4L for structural studies?

The extreme hydrophobicity of MT-ND4L presents significant challenges for recombinant expression and purification. Researchers should consider:

  • Expression systems optimized for membrane proteins: Including specialized E. coli strains (C41/C43), insect cells, or cell-free systems

  • Fusion partners: Addition of solubility-enhancing tags such as MBP or SUMO, placed at the N-terminus

  • Detergent selection: Systematic screening of detergents (DDM, LMNG, etc.) for optimal extraction while maintaining native-like conformation

  • Nanodiscs or amphipols: For maintaining protein stability in a membrane-like environment post-purification

  • Co-expression strategies: Expressing MT-ND4L together with interacting partners to enhance stability

Purification typically requires IMAC chromatography followed by size exclusion, with protein quality assessed by SDS-PAGE and mass spectrometry to confirm identity and purity greater than 80% .

How can researchers effectively model the impact of MT-ND4L mutations on Complex I energetics?

Modeling the energetic impact of MT-ND4L mutations requires a multi-scale approach:

  • Molecular dynamics simulations: To predict structural perturbations and changes in conformational flexibility

  • Quantum mechanical calculations: For electron transfer kinetics at the atomic level

  • Kinetic modeling: To quantify changes in NADH oxidation rates and proton pumping efficiency

  • Cellular bioenergetics: Measuring oxygen consumption rates, membrane potential, and ATP production

  • Integrative modeling: Combining structural, biochemical, and cellular data into comprehensive models

These approaches should be validated using recombinant proteins with introduced mutations in reconstituted systems or cellular models where the mutant protein is expressed in the context of assembled Complex I .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.