Recombinant Tinamus major Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock unless you specify a preference in your order. Please indicate any format requirements at checkout.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Tinamus major (Great tinamou) (Tetrao major)
Target Names
Target Protein Sequence
AICSLVLYLLTLMLMEKLSSNTVDAQEVELIWTILPAIVLILLALPSLQILYMMDEIDEP DLTLKAIGHQWYWSYEYTDFKDLSFDSYMIPTPDLPTGYFRLLEVDNRVVIPMESPIRMI ITAADVLHSWAVPTLGVKTDAIPGRLNQTSFITTRPGIFYGQCSEICGANHSFMPIVVES TPLPHFESWSSLLSTSSL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation, a crucial process in cellular energy production. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work together to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) composed of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase Subunit 2 and what is its functional role?

Cytochrome c oxidase subunit 2 (COX II/MT-CO2) is one of the core subunits of mitochondrial Cytochrome c oxidase (CCO), containing a dual core CuA active site that plays a significant role in physiological processes . It is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase, which is crucial for the production of ATP during cellular respiration . As part of the electron transport chain (ETC), MT-CO2 contributes to the process that couples the reduction of electron carriers during metabolism to the reduction of molecular oxygen to water and the translocation of protons from the internal mitochondrial matrix to the inter-membrane space . This process generates the electrochemical gradient used to produce ATP, powering vital cellular processes.

How do selective pressures influence MT-CO2 evolution?

Research on selective pressures affecting MT-CO2 has revealed a complex evolutionary pattern. Most codons in the COII gene are under strong purifying selection (ω << 1) due to functional constraints, but approximately 4% of sites may evolve under relaxed selective constraint (ω = 1) . Additionally, some sites may experience positive selection to compensate for amino acid substitutions in other interacting subunits.

For example, branch-site maximum likelihood models identified three sites that may have experienced positive selection within a central California sequence clade in the COII phylogeny of Tigriopus californicus . This positive selection may be driven by the need to maintain functional compatibility between the mitochondrially-encoded COII and nuclear-encoded subunits of cytochrome c oxidase and cytochrome c. This co-evolutionary pressure is particularly relevant when considering the high degree of interaction between these components in the electron transport chain.

What experimental approaches are most effective for studying MT-CO2 interactions with other components of the electron transport chain?

To study MT-CO2 interactions with other electron transport chain components, researchers should consider a multi-faceted approach:

  • Recombinant protein expression and purification: Using expression vectors like pET-32a in E. coli systems (such as Transetta DE3) allows for the production of recombinant MT-CO2 with affinity tags for purification . The purified protein (typically via Ni²⁺-NTA agarose affinity chromatography) can then be used for in vitro interaction studies.

  • Enzymatic activity assays: Spectrophotometric methods can assess the catalytic activity of recombinant MT-CO2. UV-spectrophotometer analysis has been used to demonstrate that recombinant COXII can catalyze the oxidation of substrate Cytochrome C (Cyt c) .

  • Molecular docking and structural analysis: Computational methods can predict interaction sites between MT-CO2 and other proteins or small molecules. For instance, molecular docking revealed that a sulfur atom of allyl isothiocyanate (AITC) could form a hydrogen bond with Leu-31 in one COXII protein .

  • Site-directed mutagenesis: Creating point mutations at predicted binding sites can verify their functional importance and provide insights into protein-protein or protein-substrate interactions.

How do mutations in MT-CO2 affect the assembly and function of cytochrome c oxidase?

Mutations in MT-CO2 can significantly impact the assembly and function of cytochrome c oxidase through several mechanisms:

The functional impact of these mutations can be studied using reconstituted systems with recombinant proteins, allowing researchers to assess enzymatic activity, complex assembly, and electron transfer efficiency.

What are the optimal conditions for expression and purification of recombinant Tinamus major MT-CO2?

For optimal expression and purification of recombinant Tinamus major MT-CO2, the following protocol is recommended:

Expression System:

  • Use E. coli Transetta (DE3) or similar expression systems

  • Clone the full-length MT-CO2 gene into an expression vector like pET-32a with an N-terminal His-tag

  • Induce protein expression with isopropyl β-d-thiogalactopyranoside (IPTG)

Purification Protocol:

  • Harvest cells and lyse using appropriate buffer systems

  • Purify using affinity chromatography with Ni²⁺-NTA agarose to capture the His-tagged protein

  • Verify purity by SDS-PAGE (expect >90% purity)

  • Confirm identity and molecular weight by Western Blotting

Storage Conditions:

  • Store as lyophilized powder at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as this may reduce protein activity

How can researchers assess the functional activity of recombinant MT-CO2?

Assessing the functional activity of recombinant MT-CO2 requires multiple complementary approaches:

  • Spectrophotometric enzyme assays: UV-spectrophotometer analysis can be used to measure the ability of recombinant MT-CO2 to catalyze the oxidation of substrate Cytochrome C (Cyt c) . This provides a direct assessment of electron transfer function.

  • Infrared spectroscopy: Infrared spectrometer analysis can provide information about the structural integrity and functional groups of the protein, which correlate with its activity .

  • Protein-substrate interaction studies: Using molecular docking or other binding assays can help determine if the recombinant protein maintains its ability to interact with natural substrates or inhibitors. For example, allyl isothiocyanate (AITC) interactions with specific amino acid residues can be studied .

  • Integration into membrane systems: Since MT-CO2 is normally part of a membrane-bound complex, reconstituting the protein into artificial membrane systems or liposomes can provide a more physiologically relevant assessment of its function.

  • Oxygen consumption measurements: When integrated into a functional complex, oxygen consumption rates can be measured as an indicator of cytochrome c oxidase activity.

What experimental controls are critical when studying recombinant MT-CO2 in electron transport chain research?

When studying recombinant MT-CO2 in electron transport chain research, the following controls are critical:

Protein Quality Controls:

  • Include wild-type protein as a positive control for functional assays

  • Prepare denatured protein samples as negative controls

  • Verify protein purity by SDS-PAGE (>90% purity is recommended)

  • Confirm protein identity by Western blotting or mass spectrometry

Functional Assay Controls:

  • Include no-substrate controls to establish baseline measurements

  • Use known inhibitors of cytochrome c oxidase to confirm specificity of activity

  • Include titration experiments with varying concentrations of protein to establish dose-dependence

Interaction Studies Controls:

  • Use proteins with known mutations in binding sites as negative controls

  • Include competition assays with known substrates or inhibitors

  • When studying effects of compounds like AITC, include structurally similar compounds without activity as controls

Expression System Controls:

  • Include empty vector controls to account for background host cell proteins

  • If possible, express and purify a known functional protein using the same system for comparative analysis

What are the most common issues in recombinant MT-CO2 expression and how can they be resolved?

Common issues in recombinant MT-CO2 expression and their solutions include:

Low Protein Yield:

  • Optimize codon usage for the expression host (E. coli)

  • Adjust induction conditions (IPTG concentration, temperature, duration)

  • Consider using a stronger promoter or a different expression strain

  • Test different growth media compositions to improve cell density and protein expression

Protein Insolubility:

  • Express at lower temperatures (16-20°C) to slow folding and reduce inclusion body formation

  • Use fusion partners known to enhance solubility

  • Optimize lysis buffer conditions (pH, salt concentration, detergents)

  • Consider refolding protocols if the protein consistently forms inclusion bodies

Protein Degradation:

  • Add protease inhibitors during lysis and purification

  • Reduce processing time and maintain cold temperatures throughout purification

  • Test different E. coli strains deficient in specific proteases

Poor Purity:

  • Optimize imidazole concentration in binding and elution buffers

  • Consider additional purification steps (ion exchange, size exclusion chromatography)

  • Increase washing steps during affinity purification

How can researchers differentiate between functional and non-functional recombinant MT-CO2?

Differentiating between functional and non-functional recombinant MT-CO2 requires multiple assessment methods:

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to verify secondary structure

  • Thermal shift assays to assess protein stability

  • Size exclusion chromatography to confirm proper oligomeric state

Functional Activity Tests:

  • UV-spectrophotometric assays to measure catalytic activity toward Cytochrome C oxidation

  • Oxygen consumption measurements when incorporated into functional complexes

  • Electron transfer efficiency compared to native protein controls

Binding Capability Analysis:

  • Surface plasmon resonance to measure binding kinetics with known interactors

  • Pull-down assays to verify interactions with other components of the cytochrome c oxidase complex

  • Molecular docking validation with known substrates or inhibitors, such as AITC

A functional recombinant MT-CO2 should demonstrate appropriate structural characteristics, maintain catalytic activity comparable to the native protein, and retain specific binding interactions with known partners or substrates.

What are the emerging techniques for studying MT-CO2 involvement in mitochondrial diseases?

Emerging techniques for studying MT-CO2 involvement in mitochondrial diseases include:

Advanced Genomic and Proteomics Approaches:

  • Single-cell transcriptomics to understand tissue-specific expression patterns

  • Proteome-wide interaction mapping to identify novel binding partners

  • CRISPR-Cas9 editing to create disease-relevant mutations for functional studies

High-Resolution Structural Biology:

  • Cryo-electron microscopy to visualize MT-CO2 within the intact cytochrome c oxidase complex

  • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics and conformational changes

  • Time-resolved X-ray crystallography to capture electron transfer intermediates

In Vitro Disease Modeling:

  • Patient-derived induced pluripotent stem cells (iPSCs) differentiated into affected cell types

  • Organoid systems to study tissue-specific effects of MT-CO2 mutations

  • Microfluidic "organ-on-a-chip" platforms to assess physiological impacts in controlled environments

In Vivo Approaches:

  • Development of model organisms with precise mutations matching human disease variants

  • Non-invasive imaging techniques to monitor mitochondrial function in living systems

  • Metabolic flux analysis to quantify the impact of MT-CO2 dysfunction on cellular energetics

These emerging techniques will provide deeper insights into how MT-CO2 mutations contribute to mitochondrial diseases and may reveal new therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.