Recombinant TM2 domain-containing protein C41D11.9 (C41D11.9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
C41D11.9; TM2 domain-containing protein C41D11.9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-195
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
C41D11.9
Target Protein Sequence
ISGTKDVKSKNCDGSAGLTCTFPGDCRIGDTVKVNCTSRKGCPNPVSRNNVEAVCRFCWQ LLPGDYDCEPATNCSTSSTKLLVTKCSAHSSVICMGQRNFYKRIPCNWSSGYSWTKTMIL SVVLGGFGADRFYLGLWKSAIGKLFSFGGLGVWTLVDVVLIAVGYIKPYDGSMYI
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C41D11.9

STRING: 6239.C41D11.9

UniGene: Cel.25445

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal conditions for expressing recombinant C41D11.9 protein in bacterial systems?

For successful expression of recombinant C41D11.9 protein in bacterial systems, the following methodological approach is recommended:

Expression System:

  • Host: E. coli is the preferred expression system

  • Vector: Expression vectors containing an N-terminal His-tag for purification

  • Expression region: Amino acids 21-195 (avoiding the signal peptide which can inhibit bacterial expression)

Expression Conditions:

  • Induction: IPTG induction at mid-log phase (OD600 ~0.6-0.8)

  • Temperature: Lower expression temperature (16-18°C) overnight after induction to enhance solubility

  • Media: Rich media such as TB (Terrific Broth) or LB supplemented with glucose

Purification Protocol:

  • Lyse cells in Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

  • Purify using Ni-NTA chromatography

  • Further purification via size exclusion chromatography if needed

  • Final protein should be >90% pure as determined by SDS-PAGE

Storage and Handling:

  • Store lyophilized protein at -20°C/-80°C

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

Basic Experimental Design Principles

When studying TM2 domain-containing proteins in model organisms, a comprehensive experimental design should include :

  • Clear Research Question Formulation:

    • Define independent variables (e.g., gene knockout, protein overexpression)

    • Define dependent variables (e.g., neuronal function, lifespan, signaling pathway activity)

    • Identify potential confounding variables

  • Selection of Appropriate Model System:

    • Caenorhabditis elegans for basic functional studies

    • Drosophila for developmental and neurogenic phenotype analysis

    • Mammalian cell culture for molecular interaction studies

    • Mouse models for disease relevance

  • Experimental Approaches:

    ApproachApplicationControl Type
    Gene KnockoutLoss-of-function analysisWild-type organisms
    OverexpressionGain-of-function analysisEmpty vector expression
    Domain MutagenesisStructure-function relationshipWild-type protein expression
    Tissue-specific ManipulationCell-autonomous functionAdjacent tissues, other cell types
  • Controls and Replication:

    • Include appropriate genetic background controls

    • Perform biological replicates (minimum n=3)

    • Include multiple experimental approaches to validate findings

Advanced Experimental Design

For sophisticated analysis of TM2D proteins, consider employing :

  • CRISPR/Cas9-mediated Homology Directed Repair (HDR):

    • Generate clean null alleles of all TM2D genes

    • Create single, double, and triple knockouts to assess functional redundancy

    • Introduce point mutations to assess specific domain functions

  • Time-Series Experimental Design:

    • Monitor phenotypes throughout development

    • Assess progressive phenotypes (e.g., lifespan, neurodegeneration)

    • Implement repeated measures to capture temporal dynamics

  • Factorial Experimental Designs:

    • Test multiple independent variables simultaneously

    • Analyze interactions between different genetic manipulations

    • Assess environmental factors that might modulate TM2D protein function

What is the relationship between TM2D proteins and Notch signaling, and how can this be experimentally verified?

TM2D proteins play a critical role in Notch signaling, a highly conserved cell signaling pathway essential for development and adult tissue homeostasis. The relationship is complex and can be experimentally verified through several methodological approaches:

Core Relationship:

  • TM2D proteins, including C41D11.9 homologs, regulate Notch signaling at the γ-secretase cleavage step

  • Overexpression of the conserved region of TM2D proteins acts as a potent inhibitor of Notch signaling

  • Loss of TM2D genes results in maternal-effect neurogenic defects in Drosophila

Experimental Verification Methods:

  • Genetic Interaction Studies:

    • Generate double mutants between TM2D genes and Notch pathway components

    • Quantify phenotypic enhancement or suppression

    • Assess epistatic relationships to place TM2D function within the pathway

  • Biochemical Analyses:

    • Immunoprecipitation to detect physical interactions with Notch pathway components

    • Western blotting to monitor Notch processing in TM2D mutant backgrounds

    • In vitro γ-secretase activity assays with purified components

  • Cell-Based Assays:

    • Notch reporter assays in cell culture with TM2D overexpression or knockdown

    • FACS analysis of Notch receptor surface expression

    • Live imaging of Notch trafficking in TM2D mutant cells

  • In Vivo Functional Assessments:

    • Analysis of neurogenic phenotypes in embryos

    • Quantification of Notch target gene expression using qRT-PCR

    • Immunohistochemistry to visualize Notch signaling in tissues

Research findings indicate that triple null animals (lacking all three TM2D genes) are not phenotypically worse than single nulls, suggesting these genes function together in a complex or pathway . High-throughput proteomics data has detected physical interactions between TM2D proteins, further supporting this hypothesis .

How do TM2D gene mutations contribute to Alzheimer's disease pathogenesis, and what experimental approaches can elucidate this connection?

TM2D gene mutations have been implicated in Alzheimer's disease (AD) pathogenesis through several potential mechanisms. Understanding these connections requires sophisticated experimental approaches:

Current Understanding:

  • Rare variants in TM2D3 are associated with late-onset Alzheimer's disease (LOAD)

  • In a study of 1393 LOAD cases and 8141 controls, TM2D3 mutation carriers showed significant association with AD (OR = 7.45, 95% CI: 3.49-15.90, p = 6.6x10^-9)

  • All three TM2D proteins may function together in AD-relevant processes

  • TM2D1 (also known as BBP - beta-amyloid binding protein) can interact with Aβ42, Aβ40, and potentially APP

  • TM2D proteins may be involved in phagocytosis, which is relevant to AD pathology

Experimental Approaches:

  • Human Genetics Studies:

    • Whole-exome sequencing of AD patients and controls

    • Association studies with stratification by age of onset, family history, and APOE status

    • Functional validation of identified variants

    CohortCases/ControlsTM2D3 Carriersp-valueOdds Ratio (95% CI)
    AGES-discovery143/23747 (4.9%)/20 (0.8%)5.6x10^-48.62 (3.43-21.68)
    AGES-followup290/15296 (2.1%)/6 (0.4%)6.2x10^-35.42 (1.60-18.32)
    Pooled433/390313 (3.0%)/26 (0.7%)5.9x10^-57.45 (3.49-15.90)
  • Cellular Models:

    • iPSC-derived neurons from AD patients with TM2D mutations

    • CRISPR-edited isogenic cell lines to study variant effects

    • Amyloid processing and tau phosphorylation assays

    • Electrophysiological assessments

  • Animal Models:

    • Transgenic mice expressing human TM2D variants

    • Behavioral testing for cognitive deficits

    • Histopathological analysis for AD hallmarks

    • Lifespan and progressive electrophysiological defects assessment

  • Mechanistic Studies:

    • Analysis of γ-secretase activity in TM2D mutant backgrounds

    • Investigation of potential TM2D-mediated Aβ toxicity

    • Examination of phagocytic defects in microglia expressing TM2D variants

    • Study of neuronal death mechanisms in TM2D mutant conditions

Experimental evidence indicates that loss of Almondex (TM2D3 ortholog) in Drosophila causes shortened lifespan with progressive electrophysiological defects, supporting a role for these proteins in neuronal function and potentially neurodegeneration .

Comprehensive Mutational Analysis Framework:

  • Structure-Function Domain Analysis:

    • Target the conserved DRF motif, which may mediate conformational changes

    • Analyze the transmembrane domains, which are highly conserved

    • Investigate the divergent extracellular regions between species

    • Examine the C-terminal tails, which vary among TM2D proteins

  • Mutation Design Strategy:

    DomainMutation TypeExpected EffectAnalysis Method
    DRF motifAlanine scanningDisruption of conformational changesProtein function assays, binding studies
    Transmembrane domainsConservative substitutionsAltered membrane integrationSubcellular localization, membrane topology
    Extracellular domainDeletions, chimerasAltered ligand bindingInteraction assays, signaling outputs
    C-terminal tailTruncationsModified protein interactionsCo-IP, mass spectrometry
  • Expression Systems for Mutational Analysis:

    • Bacterial expression for structural studies

    • Mammalian cell culture for trafficking and signaling

    • Drosophila in vivo models for functional assessment

    • C. elegans for evolutionary conservation studies

  • Readout Methodologies:

    • Biochemical: Protein stability, folding, aggregation propensity

    • Cellular: Subcellular localization, trafficking, degradation rates

    • Physiological: Notch signaling activity, neuronal function

    • Pathological: Amyloid binding, phagocytosis efficiency

Advanced Analysis of Disease-Associated Variants:

For assessing disease-relevant mutations, combine:

  • Computational Approaches:

    • Evolutionary conservation analysis

    • Structural modeling to predict impact

    • Molecular dynamics simulations

  • High-Throughput Functional Assays:

    • Deep mutational scanning

    • CRISPR screens of variant libraries

    • Multiplexed reporter assays

  • Correlation with Clinical Data:

    • Age of disease onset

    • Disease progression rate

    • Treatment response differences

How can researchers differentiate between direct and indirect effects when studying TM2D proteins in complex signaling pathways?

Distinguishing direct from indirect effects is crucial when studying TM2D proteins in complex signaling pathways such as Notch signaling. This requires rigorous experimental design and careful interpretation:

Methodological Approach:

  • Temporal Resolution Studies:

    • Acute vs. chronic manipulations of TM2D protein levels

    • Time-course experiments with fine temporal resolution

    • Drug-inducible or optogenetic control of protein function

    • Analysis of immediate early gene responses

  • Pathway Dissection Strategies:

    • Epistasis analysis with known pathway components

    • Targeted manipulation of specific pathway steps

    • Reconstitution of minimal systems in heterologous cells

    • In vitro biochemical reconstitution experiments

  • Protein-Protein Interaction Analysis:

    • Direct binding assays with purified components

    • Proximity labeling approaches (BioID, APEX)

    • FRET/BRET for detecting in vivo interactions

    • Split protein complementation assays

  • Experimental Controls to Distinguish Effects:

    Control TypePurposeImplementation
    Genetic rescueConfirm specificityRe-express wild-type protein in null background
    Domain-specific mutantsIsolate functional domainsExpress proteins with mutations in specific domains
    Heterologous expressionTest sufficiencyExpress minimal components in naive cells
    PharmacologicalTarget specific stepsUse pathway-specific inhibitors
  • Statistical Approaches for Causal Inference:

    • Mediation analysis to identify intervening variables

    • Structural equation modeling

    • Bayesian networks for causal discovery

    • Regression discontinuity analysis

Case Study: TM2D Proteins and Notch Signaling

Research has shown that overexpression of the most conserved region of TM2D proteins acts as a potent inhibitor of Notch signaling at the γ-secretase cleavage step . To determine whether this is a direct effect:

  • Test direct binding between TM2D proteins and γ-secretase components

  • Assess γ-secretase activity in vitro with purified components

  • Monitor Notch substrate cleavage kinetics in the presence of TM2D proteins

  • Compare effects on multiple γ-secretase substrates to identify specificity

What statistical approaches are most appropriate for analyzing data from experiments involving TM2D protein functional studies?

The selection of statistical approaches for TM2D protein functional studies should be tailored to the specific experimental design, data type, and research questions:

For Between-Subjects Experimental Designs:

When comparing different experimental groups (e.g., wild-type vs. knockout) :

  • Two-Group Comparisons:

    • Independent samples t-test for normally distributed data

    • Mann-Whitney U test for non-parametric data

    • Cohen's d for effect size estimation

  • Multiple Group Comparisons:

    • One-way ANOVA with appropriate post-hoc tests (Tukey, Bonferroni)

    • Kruskal-Wallis test for non-parametric data

    • Mixed-effects models for nested designs

  • Control for Confounding Variables:

    • ANCOVA to adjust for covariates

    • Regression analyses with interaction terms

    • Propensity score matching for observational data

For Within-Subjects Experimental Designs:

When the same subjects experience multiple conditions :

  • Paired Comparisons:

    • Paired t-test for two time points

    • Repeated measures ANOVA for multiple time points

    • Friedman test for non-parametric repeated measures

  • Time Series Analysis:

    • Longitudinal mixed models

    • Time series regression

    • Autoregressive integrated moving average (ARIMA)

For Single-Subject Experimental Designs:

Particularly useful for detailed phenotypic characterization :

  • A-B-A Withdrawal Designs:

    • Visual analysis of graphed data

    • Percentage of non-overlapping data (PND)

    • Standardized mean difference (SMD)

  • Multiple Baseline Designs:

    • Split-middle technique

    • Conservative dual-criterion (CDC)

    • Hierarchical linear modeling

Advanced Statistical Approaches:

For complex research questions about TM2D protein function:

  • Multivariate Methods:

    • Principal component analysis

    • Cluster analysis

    • Canonical correlation analysis

  • Bayesian Approaches:

    • Bayesian hypothesis testing

    • Hierarchical Bayesian modeling

    • Bayesian networks for causal inference

  • Machine Learning for Pattern Detection:

    • Support vector machines for classification

    • Random forests for feature importance

    • Neural networks for complex relationships

The choice of statistical approach should be determined during the experimental design phase and should reflect the specific hypotheses being tested about TM2D protein function, ensuring appropriate statistical power and control for multiple comparisons .

How can researchers effectively investigate the evolutionary conservation of TM2D proteins across species?

Investigating the evolutionary conservation of TM2D proteins across species requires a comprehensive approach combining comparative genomics, structural biology, and functional studies:

Methodological Framework:

  • Sequence-Based Analyses:

    • Multiple sequence alignment of TM2D proteins across diverse species

    • Phylogenetic tree construction using maximum likelihood or Bayesian methods

    • Calculation of sequence conservation scores for specific domains

    • Identification of signature motifs (e.g., the DRF motif)

    • Analysis of selection pressure using dN/dS ratios

  • Structural Conservation Assessment:

    • Homology modeling of TM2D proteins from different species

    • Structural alignment to identify conserved tertiary structures

    • Analysis of conserved surface patches that may indicate functional sites

    • Identification of conserved intramolecular interactions

  • Functional Conservation Testing:

    • Cross-species rescue experiments (e.g., can human TM2D genes rescue Drosophila mutants?)

    • Domain swap experiments between orthologs

    • Comparison of binding partners across species using proteomics

    • Assessment of subcellular localization patterns in different model organisms

  • Genomic Context Analysis:

    • Synteny analysis to identify conserved genomic neighborhoods

    • Analysis of conserved regulatory elements

    • Comparison of expression patterns across species

    • Investigation of paralog retention patterns after genome duplications

Key Findings on TM2D Evolutionary Conservation:

  • TM2D proteins are conserved in metazoans and encoded by three separate genes in each species

  • The transmembrane domains and intracellular loop (including the DRF motif) show high conservation across species

  • The extracellular regions are more divergent, suggesting potential species-specific functions

  • Functional studies in Drosophila have shown that all three TM2D genes (almondex, amaretto, biscotti) share the same maternal-effect neurogenic defect

  • The functional links between all three TM2D genes are likely to be evolutionarily conserved, suggesting the entire gene family may be involved in similar processes across species

  • Preliminary data from the International Mouse Phenotyping Consortium indicates that single knockouts of Tm2d1, Tm2d2, and Tm2d3 in mice are all recessive embryonic lethal prior to E18.5, further supporting functional conservation

What are the methodological considerations for developing high-throughput screening assays to identify modulators of TM2D protein function?

Developing effective high-throughput screening (HTS) assays for TM2D protein modulators requires careful consideration of biological relevance, assay robustness, and downstream validation:

Assay Development Strategy:

  • Target Selection and Validation:

    • Define the specific function of TM2D proteins to target (e.g., Notch signaling, phagocytosis, Aβ interaction)

    • Validate the biological relevance of the selected endpoint

    • Establish dose-response relationships with known controls

    • Determine the minimal functional domain for screening efforts

  • Assay Format Selection:

    Assay TypeApplicationAdvantagesLimitations
    Cell-based reporter assaysPathway activationPhysiologically relevantMore variables, higher noise
    Binding assaysDirect interactionClear mechanism, fewer artifactsMay miss indirect modulators
    Phenotypic assaysFunctional outcomesIdentifies modulators regardless of mechanismTarget deconvolution required
    Biochemical assaysEnzyme activityHigh reproducibility, amenable to automationMay not translate to cells
  • Assay Optimization Parameters:

    • Signal-to-background ratio (aim for >10:1)

    • Z' factor (aim for >0.5 for robust screening)

    • Coefficient of variation (<15% for reliable results)

    • DMSO tolerance (typically test up to 1%)

    • Miniaturization compatibility (384 or 1536-well formats)

    • Temporal stability (signal stability over the measurement window)

  • Control Selection:

    • Positive controls (e.g., known inhibitors of TM2D function)

    • Negative controls (vehicle only)

    • Reference compounds for quantitative normalization

    • System controls (e.g., γ-secretase inhibitors for Notch signaling assays)

  • Screening Library Considerations:

    • Diversity-oriented collections for novel chemotypes

    • Focused libraries based on structural insights

    • FDA-approved compounds for repurposing

    • Natural product extracts

    • Fragment libraries for structure-based approaches

Validation and Follow-up Strategy:

  • Hit Confirmation Cascade:

    • Repeat primary assay in duplicate or triplicate

    • Dose-response testing

    • Counter-screening against related targets for selectivity

    • Orthogonal assays to confirm mechanism

  • Mechanism of Action Studies:

    • Target engagement assays (thermal shift, surface plasmon resonance)

    • Competition assays with known ligands

    • Structure-activity relationship analysis

    • Resistance mutation studies

  • Cellular Validation:

    • Activity in multiple cell types

    • Expression profiling

    • Pathway analysis

    • Phenotypic rescue experiments

  • In Vivo Validation:

    • PK/PD studies in appropriate models

    • Efficacy in disease-relevant models

    • Toxicity assessment

    • Biomarker development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.