Recombinant TM2 domain-containing protein Y66D12A.21 (Y66D12A.21)

Shipped with Ice Packs
In Stock

Description

General Characteristics of TM2 Domain-Containing Proteins

TM2 domain-containing proteins typically have a conserved N-terminal signal sequence and two transmembrane domains, which are connected by a short intracellular loop located close to the C-terminus . An evolutionarily conserved aspartate-arginine-phenylalanine (DRF) motif exists within this loop in some G-protein coupled receptors, mediating conformational changes upon ligand binding . The region located between the signal sequence and the first transmembrane domain varies among different species and among the three TM2D-containing proteins .

Functional Diversity

TM2 domain-containing proteins exhibit functional diversity. For example, in Plasmodium falciparum, a human pathogen that causes malaria, the 2TM superfamily contains over 200 genes encoding RIFINs, STEVORs, and PfMC-2TM proteins . These proteins have a semiconserved N-terminal region with a signal peptide, two conserved TM domains flanking a hypervariable loop, and highly conserved C-terminal residues with a lysine-rich C-terminal tail after the second TM domain . The hypervariable loop, displayed on infected erythrocytes, likely generates antigenic diversity . Most Pf2TM proteins also possess a PEXEL/HT motif that facilitates protein trafficking across the PVM.

Examples of TM2 Domain-Containing Proteins

ProteinDescription
RIFINsEncoded by genes within the 2TM superfamily in Plasmodium falciparum
STEVORsEncoded by genes within the 2TM superfamily in Plasmodium falciparum
PfMC-2TM proteinsEncoded by genes within the 2TM superfamily in Plasmodium falciparum
TM2D1TM2 domain containing protein 1
TM2D2TM2 domain containing protein 2
TM2D3TM2 domain containing protein 3

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
Y66D12A.21; TM2 domain-containing protein Y66D12A.21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-329
Protein Length
Full Length of Mature Protein
Species
Caenorhabditis elegans
Target Names
Y66D12A.21
Target Protein Sequence
TVKCDDLDPNQYLCKNYAVDTITQQSVTCAADNSIQVMCETAEHIKCVGKDQFGIFNRTV PSACHYGAHVSYTTTVLLSIFLGFFGIDRIYLGYYALGLIKMFSLGGLFVFWLVDIILIS LQLLGPADGTAYAMAYYGPKAQMIRLVATIWKKNWKILEIIVEKKMKISEKLNKNDFYVE NSRKLYIFSGKFEFSVTKSSKIEFLGEKLNKKDFLNENCKKLNKNDLYVENSRRLYIFSG KFEFSVPKSSRKISIFLFFFRRKSKNREKKLKNHRKSIEIHFFFQKFFQIFIFFTFDSHT NFSFYTCDGCL
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_Y66D12A.21

UniGene: Cel.106

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is Y66D12A.21 related to other TM2D proteins across species?

Y66D12A.21 is part of a highly conserved family of TM2 domain-containing proteins found across metazoans. In each species, there are typically three separate TM2D genes:

SpeciesTM2D Family Members
HumansTM2D1, TM2D2, TM2D3
DrosophilaAlmondex (amx), CG11103/Amaretto (amrt), CG10795/Biscotti (bisc)
C. elegansY66D12A.21 and two other orthologs

While the extracellular regions vary between species and among the three proteins, the sequences of the two transmembrane domains and the intracellular loop show high conservation throughout evolution . Proteomic data has detected physical interactions between TM2D1-TM2D3 and TM2D2-TM2D3, suggesting these proteins may form a functional protein complex .

What are the optimal experimental designs for studying Y66D12A.21 function in vivo?

For studying Y66D12A.21 function in vivo, I recommend implementing both quasi-experimental and full experimental designs:

Between-Subjects Design with Control Groups

A robust approach follows the untreated control group design with dependent pretest and posttest samples:

GroupMeasurement Flow
ExperimentalO₁ₐ X O₂ₐ
ControlO₁ᵦ O₂ᵦ

Where O represents observations and X represents the experimental manipulation (e.g., Y66D12A.21 knockout or overexpression) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.