Recombinant Tobacco yellow dwarf virus Movement protein (V2)

Shipped with Ice Packs
In Stock

Description

2.1. Protein Structure

  • Sequence and Domains: The full-length V2 protein (1–102 amino acids) includes a transmembrane region and a basic N-terminal domain hypothesized to bind DNA or mediate nuclear localization .

  • Post-Translational Modifications: Recombinant V2 is often expressed with an N-terminal 10×His tag for purification .

PropertyDetail
ORF DesignationV2 (virion-sense strand)
Native FunctionEncapsidation, nuclear localization, and DNA binding
Recombinant ExpressionE. coli (in vitro)
Molecular Weight~11.2 kDa (predicted)
Purification Tag10×His-tag

2.2. Functional Roles in TYDV Infection

  • Encapsidation: Binds viral ssDNA for protection and transmission .

  • Nuclear Localization: Facilitates entry into host nuclei for replication .

  • Systemic Spread: While V1 (MP) is primarily responsible for plasmodesmata-mediated movement, V2 may assist in intracellular trafficking .

3.1. Production Methods

Recombinant V2 is synthesized via bacterial expression systems, typically using E. coli with T7 RNA polymerase-driven vectors. The protein is purified via nickel-affinity chromatography due to its His-tag .

ParameterDetail
Expression SystemE. coli (e.g., BL21(DE3) strains)
InductionIPTG (isopropyl β-D-1-thiogalactopyranoside)
PurificationNickel-NTA resin chromatography
Storage-20°C (liquid) or -80°C (lyophilized)

3.2. Research Applications

  • Protein Interaction Studies: Identifies host factors involved in viral movement or replication (e.g., retinoblastoma-related proteins) .

  • Structural Analysis: X-ray crystallography or NMR to elucidate DNA-binding motifs.

  • Diagnostic Tools: Used in ELISA assays for detecting TYDV infection in crops.

4.1. Role in Viral Pathogenicity

  • Encapsidation Dependency: Mutations in V2 (CP) abrogate systemic infection, indicating its necessity for virion assembly .

  • DNA Binding: The basic N-terminal domain may interact with viral ssDNA, stabilizing the nucleocapsid .

4.2. Host Interactions

TYDV V2 may interact with plant proteins to modulate cellular environments. For example, RepA (complementary-sense C1 ORF) binds retinoblastoma-related proteins to promote replication . While direct interactions between V2 and host factors remain understudied, analogous studies on BYDV’s 17K protein highlight potential conserved mechanisms .

StudyKey FindingSource
V2 MutagenesisDeletion of V2 prevents systemic infection in tobacco .
Nuclear LocalizationBasic domain in V2 facilitates entry into host nuclei .
Host Protein InteractionsRepA (C1 ORF) interacts with plant retinoblastoma proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are flexible. If you have a specific format preference, please indicate it in your order. We will accommodate your request as much as possible.
Lead Time
Delivery time may vary depending on your purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice packaging, please inform us beforehand as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is advisable to briefly centrifuge the vial to ensure the contents settle at the bottom. Recombinant Tobacco yellow dwarf virus Movement protein (V2) should be reconstituted in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life of Recombinant Tobacco yellow dwarf virus Movement protein (V2) is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms, on the other hand, have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store Recombinant Tobacco yellow dwarf virus Movement protein (V2) at -20°C/-80°C. For multiple uses, aliquoting is essential. To ensure optimal preservation, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your requirement.
Synonyms
V2; Movement protein; MP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Tobacco yellow dwarf virus (strain Australia) (TYDV)
Target Names
V2
Target Protein Sequence
MYPAKYQVVPSGINYSDTPVGTFEQYQPQKAGESSEHFFSKVVVALIVILFAVGIVYLAY TLFLKDLILLLKAKKQKTTTEIGFGNTPLRRPGEGNPNGGPV
Uniprot No.

Target Background

Function
Recombinant Tobacco yellow dwarf virus Movement protein (V2) plays a crucial role in the viral transport within and between cells.
Database Links

KEGG: vg:944384

Protein Families
Mastrevirus movement protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the Tobacco yellow dwarf virus Movement protein (V2) and how does it function in viral infection?

Tobacco yellow dwarf virus (TYDV) belongs to the genus Mastrevirus in the Geminiviridae family, similar to Bean yellow dwarf virus (BeYDV). The V2 protein functions as a movement protein (MP) that facilitates the cell-to-cell transport of viral genomes during infection. Movement proteins are essential for viral systemic infection as they enable the virus to spread throughout the plant .

Like other geminiviral MPs, TYDV V2 likely interacts with plant cellular components to modify plasmodesmata, creating channels through which viral nucleic acids can move between cells. This function is critical as viruses must overcome the cell wall barrier to establish successful infections. Additionally, movement proteins may play roles in suppressing host defense responses, contributing to viral pathogenicity .

How do viral movement proteins from different virus families compare structurally and functionally?

Viral movement proteins differ considerably between virus families while maintaining their core function of facilitating viral movement:

Virus FamilyRepresentativeMP FeaturesMolecular WeightMode of Action
VirgaviridaeTMVForms tubules, binds RNA30 kDaIncreases plasmodesmatal size exclusion limit
GeminiviridaeBeYDV/TYDVOften multifunctional, may form oligomers10-15 kDaInteracts with host factors to facilitate DNA movement
PotyviridaeTEVMembrane-associated~50 kDaForms pinwheel inclusions

The TMV movement protein is one of the most extensively studied, serving as a model for understanding viral movement mechanisms. It forms complex structures and modifies plasmodesmata to increase the size exclusion limit, allowing viral RNA-protein complexes to move between cells . Geminiviruses, including TYDV, generally have smaller movement proteins that often perform multiple functions in the viral life cycle .

What expression systems are commonly used to study recombinant viral movement proteins?

Several expression systems are used to study viral movement proteins, each with distinct advantages:

Expression SystemAdvantagesApplicationsExample Yields
Bacterial systems (E. coli)Rapid, high yield, cost-effectiveProtein purification, antibody productionVariable (often requires refolding)
Plant virus-based vectorsNative environment, post-translational modificationsFunctional studies, localizationUp to 1.5-2.0 mg/g leaf fresh weight
Transient Agrobacterium-mediated expressionNo stable transformation needed, rapid resultsFunctional studies in different plant species0.57-2.0 mg/g leaf fresh weight
Geminiviral replicon systemsHigh expression levels, broad host rangeProtein production, viral movement studiesEnhanced expression in multiple plant species

Geminiviral replicon systems have emerged as particularly valuable tools. These systems utilize the rolling circle replication mechanism of geminiviruses to generate high copy numbers of expression constructs, resulting in enhanced protein production. As demonstrated in the research, BeYDV-based vectors can efficiently express foreign proteins in multiple plant species, including Nicotiana benthamiana, lettuce, eggplants, tomato, peppers, melons, orchids, and roses .

What are the optimal conditions for expressing recombinant viral movement proteins in plant systems?

Optimal expression of recombinant viral movement proteins requires careful consideration of several factors:

  • Vector selection: Geminiviral replicon vectors show superior performance for expressing viral proteins compared to conventional binary vectors. The pBYR2HS vector, which incorporates tobacco mosaic virus (TMV) Ω and a heat shock protein (HSP) terminator in a double terminator construct, demonstrates enhanced expression across multiple plant species .

  • Regulatory elements: The choice of promoters, terminators, and untranslated regions significantly impacts expression levels. For instance:

    • The 35S promoter produces higher expression levels compared to NOS, vspB, UbiF, and Ubi promoters

    • Double terminators (e.g., combining HSP and other terminators) enhance protein accumulation

    • The Tobacco mosaic virus Ω 5' UTR can improve translation efficiency

  • Host selection: While N. benthamiana remains the preferred host for transient expression, various plant species support geminiviral replication and protein expression. Expression efficiency varies by species, with factors like leaf age, plant growth conditions, and Agrobacterium strain affecting outcomes .

  • Infiltration parameters: Optimal optical density of Agrobacterium cultures (typically OD600 of 0.5-1.0), infiltration buffer composition, and post-infiltration incubation conditions (temperature, light) all contribute to expression success.

  • Harvest timing: Peak accumulation of viral movement proteins typically occurs 3-5 days post-infiltration, with potential degradation after extended periods .

What are the advantages and limitations of using geminiviral vectors for expressing recombinant viral movement proteins?

Geminiviral vectors offer distinct advantages but also present certain limitations:

Advantages:

  • High expression levels: Geminiviral replication dramatically increases copy number, enhancing transcription potential. Even in the absence of Rep/RepA, the BeYDV replicon substantially increased protein expression by 3.1-fold compared to non-replicating vectors .

  • Broad host range: Unlike tobamovirus-based systems that show limited effectiveness in certain species, geminiviral vectors can replicate efficiently in a wide range of dicotyledonous plants. The BeYDV system has demonstrated effectiveness in tobacco, lettuce, eggplants, tomato, peppers, melons, orchids, and roses .

  • Rapid expression: High-level protein accumulation occurs within days of infiltration, making these systems suitable for time-sensitive experiments .

  • Versatility: Geminiviral vectors can accommodate large inserts and support simultaneous expression of multiple proteins, enabling complex experimental designs .

Limitations:

What molecular techniques are most effective for analyzing movement protein interactions with host factors?

Understanding movement protein interactions with host factors requires a combination of approaches:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitation (Co-IP)Identifying protein-protein interactionsCan detect native complexesMay miss transient interactions
Yeast two-hybrid (Y2H)Screening for interaction partnersHigh-throughput capabilityPotential for false positives/negatives
Bimolecular Fluorescence Complementation (BiFC)Visualizing interactions in plantaShows subcellular localization of interactionsIrreversible complex formation
Förster Resonance Energy Transfer (FRET)Real-time interaction dynamicsDetects nanometer-scale proximityRequires specialized equipment
Proximity-dependent biotin identification (BioID)Identifying neighboring proteinsCaptures transient interactionsPotential background labeling
Immunogold electron microscopyUltrastructural localizationHigh resolutionLabor-intensive sample preparation

For viral movement proteins, a combination of these techniques is typically required to build a comprehensive understanding of their interaction networks. Fluorescent protein fusions can provide valuable insights into subcellular localization and potential colocalization with host factors, while biochemical approaches help confirm direct interactions .

When expressing viral movement proteins for interaction studies, it's important to consider that high-level expression may alter normal cellular processes. The modulation of expression levels using the strategies discussed in section 2.2 may help maintain more physiologically relevant conditions for interaction studies .

How can researchers optimize viral movement protein solubility and stability for biochemical studies?

Viral movement proteins often present challenges for biochemical studies due to their hydrophobic nature and tendency to form aggregates. Several strategies can enhance their solubility and stability:

  • Expression optimization:

    • Using fusion tags such as maltose-binding protein (MBP), glutathione S-transferase (GST), or SUMO can dramatically improve solubility

    • Lowering expression temperature (16-20°C) often increases proper folding

    • Coexpression with chaperones can reduce aggregation

  • Buffer optimization:

    • Screening different pH conditions (typically pH 7.0-8.5)

    • Including mild detergents (0.05-0.1% Tween-20, Triton X-100, or NP-40)

    • Adding stabilizing agents (5-10% glycerol, 100-500 mM NaCl)

    • Including reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Purification strategies:

    • Using affinity chromatography followed by size exclusion to remove aggregates

    • Implementing on-column refolding for proteins purified from inclusion bodies

    • Considering native purification from plant material for maintaining post-translational modifications

  • Storage considerations:

    • Flash freezing in small aliquots with cryoprotectants

    • Determining optimal storage buffer conditions through thermal shift assays

    • Monitoring protein stability over time using dynamic light scattering

For oligomeric viral proteins like movement proteins, which may form high molecular weight complexes similar to those observed with Rep and RepA (showing large complexes near 250 kDa in size under non-reducing conditions), special attention should be paid to maintaining the native oligomeric state if it's important for biological function .

What approaches are effective for studying the role of movement proteins in viral systemic movement?

Studying viral systemic movement requires specialized techniques to track virus spread through plants:

  • Fluorescent protein-based tracking systems:

    • Creating viral constructs expressing fluorescent proteins (GFP, RFP) to visualize movement

    • Using confocal microscopy for real-time tracking of viral spread

    • Measuring cell-to-cell movement rates through time-course imaging

  • Trans-complementation assays:

    • Developing movement-deficient viral mutants that can be rescued by providing functional movement protein in trans

    • The TMV-derived pAT-transMP vector system demonstrates how trans-complementation of MP enables efficient expression and movement

  • Microinjection and bombardment studies:

    • Directly introducing viral nucleic acids into specific cells

    • Tracking subsequent spread to neighboring cells

  • Grafting experiments:

    • Creating chimeric plants with wild-type and movement protein-deficient sections

    • Analyzing viral movement across graft junctions

  • Immunolocalization:

    • Using specific antibodies to track viral proteins during infection

    • Combining with host cell markers to understand trafficking pathways

  • CRISPR-Cas9 approaches:

    • Engineering viral vectors expressing Cas9 and guide RNAs targeting movement protein genes

    • As demonstrated with TMV-MP, viral expression of competent CRISPR-Cas9 protein in a single construct can facilitate gene editing studies of movement protein function

When implementing these approaches, researchers should consider that modifying viral replication can affect both cell death responses and protein accumulation. Finding the optimal balance, as described in the research where modest reduction in expression of Rep and RepA reduced plant leaf cell death and increased target protein accumulation, is crucial for successful experiments .

How do viral movement proteins interact with the plant cytoskeleton during infection?

Movement proteins often utilize the plant cytoskeleton for efficient viral trafficking. Current research methodologies include:

  • Live-cell imaging approaches:

    • Using dual-labeled systems with fluorescently tagged movement proteins and cytoskeletal components

    • Implementing high-resolution techniques such as structured illumination microscopy (SIM) or stochastic optical reconstruction microscopy (STORM)

    • Applying photobleaching techniques (FRAP, FLIP) to study dynamics

  • Pharmacological inhibitor studies:

    • Utilizing cytoskeleton-disrupting compounds (cytochalasin D, latrunculin B for actin; oryzalin, colchicine for microtubules)

    • Analyzing the impact on viral movement through time-course experiments

  • Cytoskeleton-associated protein mutations:

    • Creating plant lines with mutations in key cytoskeletal proteins

    • Assessing changes in viral movement efficiency

  • Biochemical interaction studies:

    • Performing in vitro co-sedimentation assays with purified movement proteins and cytoskeletal components

    • Using atomic force microscopy to visualize interactions at the molecular level

Research with TMV movement protein has demonstrated interactions with microtubules and microfilaments, which may provide insights for studying TYDV V2 protein interactions . The viral expression systems described in the search results could be adapted to express fluorescently tagged movement proteins for studying these interactions in vivo.

How can CRISPR-Cas9 gene editing be integrated with viral vector systems to study movement protein function?

CRISPR-Cas9 technology offers powerful approaches for studying viral movement proteins:

  • Direct viral genome editing:

    • Engineering viral constructs expressing Cas9 and guide RNAs targeting movement protein genes

    • Creating precise mutations to study structure-function relationships

    • Analyzing phenotypic effects on viral movement and pathogenicity

  • Host factor modification:

    • Identifying and modifying plant genes involved in movement protein interactions

    • Creating knockout or knock-in lines to study specific interaction domains

  • Integrated viral expression systems:

    • The TMV-derived vector system demonstrates that viral expression of competent CRISPR-Cas9 protein is achievable in a single pAT-transMP construct

    • This approach enables simultaneous viral movement protein expression and gene editing

  • Temporal control of editing:

    • Using inducible promoters to control timing of gene editing events

    • Studying movement protein function at different stages of infection

  • Multiplex editing approaches:

    • Targeting multiple viral or host genes simultaneously

    • Unraveling complex interaction networks involving movement proteins

When implementing these approaches, researchers should consider vector design carefully. The research indicates that modifying replicon vectors by introducing changes in the 5' UTR can reduce expression toxicity while maintaining functionality, which may be particularly important when expressing both movement proteins and CRISPR components .

What molecular mechanisms underlie movement protein-induced plant hypersensitive responses?

Understanding how viral movement proteins trigger plant defense responses involves several experimental approaches:

  • Transcriptomic and proteomic analyses:

    • Comparing host responses to wild-type and mutant movement proteins

    • Identifying defense pathways specifically activated by movement protein expression

    • Time-course experiments to track defense response progression

  • Mutational analyses of movement proteins:

    • Creating targeted mutations in functional domains

    • Correlating specific regions with defense induction

    • Developing movement protein variants with reduced immunogenicity

  • Defense marker monitoring:

    • Tracking expression of defense genes (PR proteins, ROS enzymes)

    • Measuring reactive oxygen species production

    • Analyzing callose deposition and cell wall modifications

  • Co-expression with defense suppressors:

    • Testing if known viral suppressors of RNA silencing or defense responses can mitigate movement protein-induced cell death

    • Identifying specific defense pathways involved

Research has shown that BeYDV Rep, RepA, and vector replication all elicit the plant hypersensitive response, resulting in cell death. Importantly, a modest reduction in expression of Rep and RepA reduces plant leaf cell death which, despite reducing the accumulation of viral replicons, increases target protein accumulation . This suggests that fine-tuning movement protein expression levels may help balance between efficient protein production and minimizing defense responses.

A single nucleotide change in the 5′ untranslated region (UTR) from AAC ATG to CAC ATG reduced Rep/RepA expression, reduced cell death, and enhanced protein production . Similar strategies could potentially be applied to modify movement protein expression for reduced immunogenicity while maintaining function.

How do movement proteins from different geminivirus species compare in their functional mechanisms?

Movement proteins from different geminivirus species show both conserved and distinct features:

Geminivirus SpeciesMovement ProteinUnique FeaturesHost RangeResearch Methods
Bean yellow dwarf virus (BeYDV)MPUsed in vector development, broad host compatibilityBroad dicot rangeReplicon systems, expression studies
Tobacco yellow dwarf virus (TYDV)V2Mastreviral movement proteinTobacco, tomato, beanTrans-complementation assays
Maize streak virus (MSV)MPRequires RepA for efficient functionMonocots (cereals)Replication-deficient mutants
Tomato yellow leaf curl virus (TYLCV)V2RNA silencing suppressor activityTomato, tobaccoSilencing suppression assays

Research approaches for comparative analysis include:

  • Domain swapping experiments:

    • Creating chimeric movement proteins with domains from different viruses

    • Determining which regions confer specific functional properties

  • Trans-complementation assays:

    • Testing if movement proteins from one virus can rescue movement defects in another

    • The TMV-derived pAT-transMP system demonstrates how trans-complementation approaches can be used to study movement protein functions

  • Comparative structural biology:

    • Solving structures of multiple movement proteins

    • Identifying conserved structural elements despite sequence divergence

  • Host range determinants:

    • Correlating movement protein sequences with host specificity

    • The broad host range of BeYDV in dicotyledonous plants provides a model for understanding how movement proteins contribute to host adaptation

Future research should focus on developing standardized assays for comparing movement protein functions across virus families, which would facilitate more systematic analyses of evolutionary relationships and functional specializations.

What emerging technologies show promise for advancing viral movement protein research?

Several cutting-edge technologies are poised to transform research on viral movement proteins:

  • Cryo-electron microscopy:

    • Determining high-resolution structures of movement proteins in complex with host factors

    • Visualizing movement protein-nucleic acid complexes

  • Single-molecule tracking:

    • Following individual movement protein molecules in living cells

    • Determining real-time dynamics and interaction kinetics

  • Massively parallel mutagenesis:

    • Creating comprehensive libraries of movement protein variants

    • High-throughput screening for functional properties

  • Artificial intelligence applications:

    • Predicting movement protein structures from sequence data

    • Identifying potential host interaction partners

  • Nanobody technology:

    • Developing highly specific binders to different movement protein conformations

    • Tracking and potentially inhibiting specific functions in vivo

  • Cell-free expression systems:

    • Rapid production and functional testing of movement protein variants

    • Reconstituting movement protein complexes in vitro

  • Improved viral vector systems:

    • The continued development of vectors like the pBYR2HS system with double terminators shows promise for enhanced expression

    • Combining geminiviral replication with optimized regulatory elements may yield next-generation expression systems

These emerging technologies, when combined with the established methodologies described in previous sections, promise to provide unprecedented insights into the molecular mechanisms of viral movement proteins and their interactions with host systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.