Recombinant Todarodes pacificus Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare your product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
RHO; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-448
Protein Length
Full Length of Mature Protein
Species
Todarodes pacificus (Japanese flying squid) (Ommastrephes pacificus)
Target Names
RHO
Target Protein Sequence
GRDLRDNETWWYNPSIVVHPHWREFDQVPDAVYYSLGIFIGICGIIGCGGNGIVIYLFTK TKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFLKKWIFGFAACKVYGFIGGIFGFM SIMTMAMISIDRYNVIGRPMAASKKMSHRRAFIMIIFVWLWSVLWAIGPIFGWGAYTLEG VLCNCSFDYISRDSTTRSNILCMFILGFFGPILIIFFCYFNIVMSVSNHEKEMAAMAKRL NAKELRKAQAGANAEMRLAKISIVIVSQFLLSWSPYAVVALLAQFGPLEWVTPYAAQLPV MFAKASAIHNPMIYSVSHPKFREAISQTFPWVLTCCQFDDKETEDDKDAETEIPAGESSD AAPSADAAQMKEMMAMMQKMQQQQAAYPPQGYAPPPQGYPPQGYPPQGYPPQGYPPQGYP PPPQGAPPQGAPPAAPPQGVDNQAYQA
Uniprot No.

Target Background

Function
Photoreceptor essential for image-forming vision at low light intensities (Probable). Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Signaling mediates the activation of phospholipase C (Probable). Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Retina, rhabdomere membrane (at protein level).

Q&A

What are the key structural features of Todarodes pacificus Rhodopsin?

Todarodes pacificus rhodopsin is a photoreceptor membrane protein in the retina and serves as a prototypical member of the G-protein-coupled receptor (GPCR) family. It contains 448 amino acids with a molecular weight of approximately 50 kDa, making it significantly larger than vertebrate rhodopsins which are typically around 100 residues shorter. This size difference is primarily due to a unique 10 kDa C-terminal extension composed of six repeats of the consensus sequence Pro-Pro-Gln-Gly-Tyr followed by proline-rich sequences . The full amino acid sequence includes several transmembrane domains characteristic of GPCRs and forms a structure with significant functional importance in light detection and signal transduction pathways .

How does squid rhodopsin differ functionally from vertebrate rhodopsins?

The functional differences between squid and vertebrate rhodopsins center on their signaling mechanisms. Squid rhodopsin, including that from Todarodes pacificus, triggers IP3 (inositol trisphosphate) signaling cascades, while vertebrate rhodopsins typically activate the retina-specific cGMP signaling pathway . While vertebrate photoreceptor cells have evolved specialized machinery for signal amplification, squid rhodopsin provides valuable insights into G-protein activation mechanisms, particularly those involving Gq-type G-proteins. Unlike bovine meta-rhodopsin, which cannot activate Gq-type G-proteins, squid rhodopsin offers an excellent model for understanding IP3-mediated signaling cascades that are widespread among GPCRs .

What optimal conditions are required for handling recombinant Todarodes pacificus Rhodopsin?

For optimal handling of recombinant Todarodes pacificus Rhodopsin, storage at -20°C is recommended for routine use, while -80°C is preferred for extended storage to maintain protein integrity. The protein is typically supplied in a Tris-based buffer with 50% glycerol, which helps stabilize the protein structure . To preserve functionality, repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and functional deterioration. For ongoing experiments, working aliquots can be stored at 4°C for up to one week without significant loss of activity . When designing experiments, researchers should consider these storage parameters to ensure consistent results and reliable protein performance.

What methods have proven successful for crystallizing Todarodes pacificus Rhodopsin?

Successful crystallization of Todarodes pacificus rhodopsin has been achieved using the sitting-drop vapor-diffusion method with specific modifications to accommodate this membrane protein. The protocol involves first treating the rhodopsin with V8 protease to remove the C-terminal extension, which may interfere with crystal formation. The truncated rhodopsin is then selectively extracted from microvillar membranes using alkyl glucoside in the presence of zinc ions, which help stabilize the protein structure . For optimal crystal growth, researchers have found that octylglucoside as a detergent combined with ammonium sulfate as a precipitant produces hexagonal crystals capable of diffracting to 2.8 Å resolution. This crystallization approach has yielded crystals belonging to space group P62, with unit-cell parameters a = b = 122.1, c = 158.6 Å .

What are the critical factors affecting diffraction quality of Todarodes pacificus Rhodopsin crystals?

The diffraction quality of Todarodes pacificus rhodopsin crystals is influenced by several critical factors that researchers must carefully control. First, the removal of the C-terminal extension through V8 protease treatment significantly improves crystal formation and quality by reducing molecular flexibility . Second, the choice of detergent is crucial, with octylglucoside showing superior results for producing well-diffracting crystals compared to other detergents. Third, the presence of zinc ions during extraction helps maintain protein stability and proper folding, which directly impacts crystal quality . Fourth, the precise composition of the crystallization solution, particularly the concentration of ammonium sulfate as a precipitant, affects crystal growth and diffraction properties. Finally, maintaining the integrity of the protein's native conformation throughout purification and crystallization processes is essential for achieving the 2.8 Å resolution observed in successful experiments .

How do the targeting mechanisms of Todarodes pacificus Rhodopsin compare to those of vertebrate rhodopsins?

The targeting mechanisms of invertebrate rhodopsins, like that of Todarodes pacificus, fundamentally differ from vertebrate rhodopsins despite their structural similarities. While vertebrate rhodopsins rely on a conserved QVxPA motif at the very C-terminus for proper targeting to photoreceptor membranes, invertebrate rhodopsins do not require this region . This represents a major evolutionary divergence in protein trafficking mechanisms. Studies with Drosophila rhodopsin have demonstrated that truncated variants lacking the last 23 amino acids still properly localize to rhabdomeres (the invertebrate equivalent of vertebrate outer segments) . Instead of the C-terminus, invertebrate rhodopsins depend on helix 8—an amphipathic region following the last transmembrane domain—for correct localization. This helix contains conserved amino acid residues specific to invertebrate visual rhodopsins that are not found in vertebrate homologs, suggesting it serves as a binding domain for invertebrate-specific targeting factors .

What insights can structural studies of Todarodes pacificus Rhodopsin provide for understanding other IP3-linked GPCRs?

Structural studies of Todarodes pacificus rhodopsin offer valuable insights for understanding other IP3-linked GPCRs, representing a significant advantage over vertebrate rhodopsin models. While the crystal structure of bovine rhodopsin has been widely used as a template for studying other GPCRs, it activates a retina-specific cGMP signaling pathway rather than the IP3 pathway common to approximately 90% of all GPCRs . In contrast, squid rhodopsin triggers IP3 signaling cascades through Gq-type G-proteins, making it a more relevant structural model for the majority of GPCRs involved in diverse physiological processes. High-resolution structural data from squid rhodopsin crystals can therefore provide crucial information about the structural motifs required for activation of Gq-type G-proteins and initiation of IP3-mediated signaling cascades, which have remained poorly understood despite their widespread importance in cell signaling .

What expression systems are most effective for producing functional recombinant Todarodes pacificus Rhodopsin?

While the search results don't provide specific information about expression systems for recombinant Todarodes pacificus rhodopsin, we can infer approaches based on the available data and general principles for GPCR expression. Effective expression systems likely include insect cell lines such as Sf9 or High Five cells, which provide the eukaryotic machinery necessary for proper folding and post-translational modifications of complex membrane proteins. For functional expression, the system must support proper insertion of the protein into membranes, correct disulfide bond formation, and appropriate glycosylation. The expression construct would need to be designed to include the 448 amino acid sequence identified in the search results , potentially with modifications such as the removal of the C-terminal extension to improve expression and stability, similar to the approach used for crystallization studies .

How can researchers effectively verify the functional integrity of purified Todarodes pacificus Rhodopsin?

Researchers can verify the functional integrity of purified Todarodes pacificus rhodopsin through several complementary approaches. Spectroscopic analysis should be performed to confirm the characteristic absorption spectrum of properly folded rhodopsin with bound retinal chromophore. A functional rhodopsin will show absorbance maxima typical of invertebrate visual pigments and demonstrate the expected spectral shifts upon light activation. G-protein activation assays can assess the ability of the purified protein to stimulate Gq-type G-proteins and trigger downstream signaling events, confirming its signaling competence. Additionally, ligand binding assays using fluorescently labeled retinal analogs can verify the protein's ability to bind its natural chromophore. For structural integrity assessment, circular dichroism spectroscopy can evaluate secondary structure content, while thermal stability assays can determine if the protein exhibits the expected thermal denaturation profile characteristic of properly folded rhodopsin .

What methodological approaches enable successful truncation and modification of Todarodes pacificus Rhodopsin for research applications?

Successful truncation and modification of Todarodes pacificus rhodopsin can be achieved using several methodological approaches. For C-terminal truncation, controlled proteolysis using V8 protease has proven effective in removing the unique C-terminal extension while preserving the core structure, as demonstrated in crystallization studies . For generating specific truncation variants, molecular biology techniques including site-directed mutagenesis to introduce stop codons at desired positions in the rhodopsin coding sequence allows for precise control over protein length. The research with Drosophila rhodopsin provides a model for creating truncation mutants through PCR-based methods, where specific primers generate constructs encoding desired amino acid residues . When designing fusion proteins, incorporating a glycine-rich linker (like the three-glycine linker used in Drosophila studies) between rhodopsin and tags such as GFP helps maintain proper folding and function of both protein domains .

How can structural differences between squid and vertebrate rhodopsins be leveraged for selective drug targeting?

The structural differences between squid and vertebrate rhodopsins present unique opportunities for selective drug targeting in both basic research and potential therapeutic applications. The distinct IP3 signaling pathway of squid rhodopsin versus the cGMP pathway of vertebrate rhodopsins provides a basis for developing compounds that selectively modulate one pathway without affecting the other . The absence of the conserved QVxPA motif in squid rhodopsin and the presence of unique conserved residues in helix 8 offer specific binding sites for selective ligands . Researchers could design small molecules that specifically interact with these invertebrate-specific structural elements to modulate rhodopsin function. These structural differences could be particularly valuable for developing research tools to investigate GPCR signaling mechanisms or for creating pesticides targeting invertebrate visual systems with minimal impact on vertebrate vision .

What research approaches can elucidate the role of the unique C-terminal extension in Todarodes pacificus Rhodopsin?

Elucidating the role of the unique C-terminal extension in Todarodes pacificus rhodopsin requires a multifaceted research approach. Progressive truncation analysis, similar to that conducted with Drosophila rhodopsin, can be employed to create a series of C-terminal deletion mutants with varying lengths of the extension removed . These variants should be expressed in appropriate cell systems and evaluated for membrane localization, protein stability, and signaling capability to determine which regions are essential for specific functions. Yeast two-hybrid or pull-down assays can identify binding partners that specifically interact with the unique Pro-Pro-Gln-Gly-Tyr repeats, potentially revealing signaling or structural roles for this domain. Phosphorylation analysis can determine if the proline-rich sequences serve as sites for regulatory post-translational modifications. Additionally, comparative analysis across multiple cephalopod species could reveal evolutionary conservation patterns within this extension, highlighting functionally important regions .

How might research on Todarodes pacificus Rhodopsin inform our understanding of retinal degenerative diseases?

Research on Todarodes pacificus rhodopsin offers unique perspectives for understanding retinal degenerative diseases despite the evolutionary distance from human visual systems. The distinct targeting mechanisms of invertebrate rhodopsins, particularly the critical role of helix 8 rather than the C-terminus, provide comparative insights into protein trafficking pathways that might be relevant to human disease . In humans, mutations in rhodopsin that disrupt proper trafficking to photoreceptor membranes represent the most frequent cause of autosomal dominant Retinitis Pigmentosa, a degenerative retinal condition leading to progressive blindness . By understanding the fundamental mechanisms of rhodopsin targeting across species, researchers may identify conserved quality control pathways or alternative trafficking routes that could be therapeutically targeted. Additionally, the IP3 signaling pathway utilized by squid rhodopsin intersects with calcium signaling mechanisms implicated in various forms of retinal degeneration, potentially offering new therapeutic targets .

What are the most common challenges in working with recombinant Todarodes pacificus Rhodopsin and how can they be addressed?

Working with recombinant Todarodes pacificus rhodopsin presents several challenges that researchers should anticipate and address. First, maintaining protein stability during purification and storage is critical; researchers should adhere to the recommended storage conditions (-20°C for routine use, -80°C for long-term storage) and avoid repeated freeze-thaw cycles . Using a Tris-based buffer with 50% glycerol helps maintain protein integrity, and working aliquots should be stored at 4°C for no more than one week . Second, the hydrophobic nature of this membrane protein makes it prone to aggregation; including appropriate detergents at critical concentrations throughout purification and experimental procedures helps maintain solubility. Third, preserving the native conformation with the retinal chromophore properly bound requires careful handling and protection from excessive light exposure. Finally, when designing expression constructs, researchers should consider whether to include or remove the C-terminal extension based on their specific experimental goals, as this region may affect protein behavior but is not required for basic rhodopsin function .

How should experiments be designed to accurately compare vertebrate and invertebrate rhodopsin trafficking mechanisms?

Designing experiments to accurately compare vertebrate and invertebrate rhodopsin trafficking mechanisms requires careful consideration of several factors. First, researchers should create comparable expression constructs of both rhodopsin types fused to the same fluorescent reporter (such as GFP) with consistent linker sequences to ensure fair comparison of localization patterns . Second, truncation mutants should be generated systematically, removing specific domains (C-terminus, helix 8) in both vertebrate and invertebrate rhodopsins to directly compare their importance in trafficking . Third, experiments should be conducted in appropriate cell types that represent each rhodopsin's native environment—mammalian photoreceptor cells or cell lines for vertebrate rhodopsins and invertebrate photoreceptors (such as Drosophila) for invertebrate rhodopsins. Multiple complementary techniques should be employed for localization analysis, including direct in vivo fluorescence visualization, immunofluorescence with appropriate markers for subcellular compartments, and biochemical fractionation to quantify membrane association .

What considerations are important when interpreting crystallographic data from Todarodes pacificus Rhodopsin studies?

When interpreting crystallographic data from Todarodes pacificus rhodopsin studies, several important considerations must be kept in mind. First, researchers should recognize that the crystals were obtained using truncated rhodopsin with the C-terminal extension removed, which might influence certain structural aspects compared to the full-length native protein . Second, the presence of detergents (octylglucoside) in the crystallization process can affect the conformational state of the protein and potentially alter the arrangement of flexible regions . Third, crystal packing forces may impose constraints on protein structure that differ from its native membrane environment, particularly affecting the orientation of transmembrane helices. Fourth, the resolution limit of 2.8 Å means that fine details, such as water molecules and side chain orientations, may not be precisely defined in all regions of the structure . Finally, researchers should consider the functional state of the crystallized protein (dark state vs. light-activated) when interpreting structural features related to activation mechanisms and compare findings with complementary techniques such as spectroscopy and biochemical assays .

What emerging technologies could advance structural studies of Todarodes pacificus Rhodopsin beyond crystallography?

Emerging technologies offer promising approaches to advance structural studies of Todarodes pacificus rhodopsin beyond traditional crystallography. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology and could provide high-resolution structures of rhodopsin in different conformational states without the constraints of crystal packing. This technique is particularly valuable for capturing transient conformations during the photoactivation process . Single-particle analysis combined with advanced image processing algorithms could reveal structural heterogeneity that might be masked in crystallography. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) could provide insights into protein dynamics and solvent accessibility of different regions, complementing static structural information. Computational approaches, including molecular dynamics simulations based on existing structural data, could elucidate rhodopsin's conformational flexibility and interactions with lipids in a membrane environment. Advanced solid-state NMR spectroscopy techniques specifically developed for membrane proteins offer another avenue for structural analysis in near-native lipid environments .

How might comparative studies between cephalopod rhodopsins further our understanding of visual adaptation in marine environments?

Comparative studies between rhodopsins from different cephalopod species, including Todarodes pacificus and others adapted to various marine environments, could reveal fascinating insights into visual evolution and adaptation. By analyzing sequence variations in rhodopsins from deep-sea versus shallow-water cephalopods, researchers could identify specific amino acid substitutions that optimize spectral sensitivity for different light environments . Functional characterization of these rhodopsin variants through spectroscopic analysis and G-protein activation assays would connect sequence differences to adaptive advantages. The unique C-terminal extensions found in cephalopod rhodopsins present an intriguing area for comparative analysis, as variations in the Pro-Pro-Gln-Gly-Tyr repeat patterns might correlate with specific visual ecology or signaling requirements . Structural studies comparing rhodopsins from species inhabiting different depths could reveal adaptations in protein stability under varying pressure conditions. Additionally, comparing the kinetics of photoactivation and regeneration across species could identify mechanisms that optimize visual performance in specific marine light environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.