Recombinant Tolumonas auensis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Tolumonas auensis ATP Synthase Subunit a (atpB)

ATP synthase is a multisubunit enzyme responsible for ATP synthesis via oxidative phosphorylation or photosynthesis. Subunit a (encoded by atpB) is a core component of the membrane-embedded F<sub>O</sub> sector, facilitating proton translocation and coupling with the F<sub>1</sub> catalytic domain . The recombinant form of Tolumonas auensis subunit a (UniProt ID: C4LDW6) is produced in Escherichia coli with an N-terminal His-tag, enabling purification and functional studies .

Key Features:

PropertyDetail
Host OrganismTolumonas auensis (strain DSM 9187 / TA4)
Expression SystemE. coli
TagN-terminal His-tag
Amino Acid Sequence1-259 residues (full-length)
Molecular FunctionProton channel formation in F<sub>O</sub> sector

Role in ATP Synthase Mechanism

Subunit a interacts with the c-ring rotor in F<sub>O</sub> to create a proton pathway across the membrane. Structural studies of bacterial ATP synthases (e.g., Bacillus PS3) reveal that subunit a contains critical loops and helices that stabilize the rotor-stator interface . In T. auensis, the recombinant subunit a likely retains these features, enabling proton translocation coupled to c-ring rotation .

Biochemical Studies

The recombinant protein is used to:

  • Investigate proton translocation mechanisms in extremophiles .

  • Analyze subunit interactions via crosslinking or cryo-EM .

  • Engineer ATP synthases with altered ion specificity (e.g., Na<sup>+</sup> vs. H<sup>+</sup>) .

Mutagenesis and Functional Analysis

Studies on homologous subunits (e.g., Bacillus pseudofirmus) highlight the importance of residues like Lys-180 in proton coupling. Mutations here impair ATP synthesis at near-neutral pH, underscoring subunit a’s role in environmental adaptation .

Evolutionary and Ecological Context

Tolumonas auensis is a Gram-negative, facultative anaerobe isolated from freshwater sediments . Its ATP synthase likely supports energy metabolism in diverse environments, including toluene-producing conditions . The recombinant subunit a provides a model for studying ATP synthase adaptation in anaerobic, metabolically versatile bacteria.

Future Directions

  • Structural resolution: Cryo-EM studies of full-length recombinant atpB could clarify its interaction with the c-ring .

  • Biotechnological engineering: Modifying subunit a to optimize ATP synthesis in industrial microbes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Tola_3139; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Tolumonas auensis (strain DSM 9187 / TA4)
Target Names
atpB
Target Protein Sequence
MASTGETLTSQEYIAHHLHHLQVGSGFWTVNIDSMVFSVVLGTLFIWLFRRVAVKATSGV PGKLQCFVEIVFGFVDDTVKGIFHGKNKLIAPLALTIFVWIFLMNAMDLLPIDYLPHLAQ ISNIPYLRVVPSADVNITLSMALGVFFLILFYSIKIKGIGGFVKELTMTPFNHWAFVPIN LLLETVTLISKPISLGLRLFGNMYAGEMIFILIAAMLPWWSQWFLNVPWAIFHILIITLQ AFIFMVLTIVYLSMACEEH
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (atpB) and its role in T. auensis?

ATP synthase subunit a (atpB) is a critical component of the F₀ sector of the F₀F₁-ATP synthase complex in Tolumonas auensis. This membrane-embedded subunit forms part of the proton channel that facilitates proton translocation across the cellular membrane. The a-subunit works in conjunction with the rotating c-ring to convert the energy of protons moving down their concentration gradient into mechanical energy, which is ultimately used for ATP synthesis . In T. auensis, this protein consists of 259 amino acids and plays an essential role in the organism's energy metabolism under both oxic and anoxic conditions .

What is the evolutionary significance of studying T. auensis atpB?

T. auensis represents an interesting evolutionary case study as it belongs to the family Aeromonadaceae and possesses unique metabolic capabilities, particularly its ability to produce toluene from phenylalanine and other phenyl precursors . Studying its ATP synthase can provide insights into:

  • Adaptations for energy metabolism in facultative anaerobes that can grow under both oxic and anoxic conditions

  • Evolutionary relationships within Gammaproteobacteria, particularly between T. auensis and other members of Aeromonadaceae

  • The co-evolution of energy production systems with specialized metabolic pathways like toluene biosynthesis

The ATP synthase complex represents a highly conserved molecular machine across diverse life forms, making it valuable for understanding both ancient conserved mechanisms and species-specific adaptations in energy metabolism .

What are the optimal conditions for expressing recombinant T. auensis atpB in E. coli?

Based on successful expression protocols for T. auensis atpB, the following conditions are recommended:

Expression System:

  • Host: E. coli (BL21 or similar expression strain)

  • Vector: pET series with N-terminal His-tag for purification

  • Induction: IPTG at 0.5-1.0 mM when culture reaches OD₆₀₀ of 0.6-0.8

Culture Conditions:

  • Medium: LB supplemented with appropriate antibiotics

  • Temperature: 30°C pre-induction, 25°C post-induction to enhance protein folding

  • Duration: 4-6 hours post-induction or overnight at lower temperatures

Optimization Considerations:

  • Codon optimization may improve expression levels, as T. auensis has a G+C content of 49 mol%

  • Co-expression with chaperones may enhance proper folding

  • Using auto-induction media can improve yield for difficult-to-express membrane proteins

It's important to note that as a membrane protein, atpB may present challenges in expression and folding. Pilot experiments comparing different expression conditions are recommended .

What purification methods are most effective for T. auensis atpB?

For purification of recombinant His-tagged T. auensis atpB:

Extraction:

  • Cell lysis by sonication or pressure homogenization in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Membrane fraction isolation by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilization of membrane proteins using mild detergents (0.5-1% n-dodecyl-β-D-maltoside or similar)

Purification Steps:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Optional ion exchange chromatography for higher purity

  • Size exclusion chromatography for final polishing

Buffer Considerations:

  • Maintain detergent concentration above critical micelle concentration throughout purification

  • Include glycerol (10-15%) for stability

  • Consider adding lipids for stabilization post-purification

  • Store purified protein at -80°C in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, appropriate detergent, and 1 mM DTT

Quality Control:

  • SDS-PAGE should show a band at approximately 28 kDa

  • Western blot using anti-His antibodies can confirm identity

  • Mass spectrometry can verify sequence integrity

How can functionality of recombinant T. auensis atpB be verified?

Functional verification of recombinant atpB requires reconstitution into a complete ATP synthase complex or assessment of specific a-subunit properties:

Reconstitution Approaches:

  • Co-expression with other ATP synthase subunits to form complete complex

  • Incorporation into liposomes (proteoliposomes) to create artificial membrane system

  • Complementation studies in ATP synthase-deficient bacterial strains

Functional Assays:

  • ATP Synthesis Activity:

    • Establish proton gradient across proteoliposome membrane using K⁺/valinomycin system

    • Add ADP and inorganic phosphate

    • Measure ATP production using luciferase assay or HPLC

  • Proton Translocation:

    • Monitor pH changes using pH-sensitive fluorescent dyes

    • Measure proton flux in reconstituted systems

  • Structural Integrity:

    • Blue Native-PAGE to assess complex formation

    • Immunoprecipitation with antibodies against other ATP synthase subunits

Table 1: Comparative ATP Synthesis Rates for Different Bacterial ATP Synthases

ATP Synthase SourceATP Synthesis Rate (nmol·min⁻¹·mg protein⁻¹)Threshold for ATP Synthesis (mV)Reference
E. callanderi~99.287
A. woodiiSimilar to E. callanderi90
P. modestumNot specified120
E. coliNot specified150
T. auensisTo be determinedLikely 90-150 (predicted)N/A

How can structure-function studies of T. auensis atpB advance our understanding of ATP synthase mechanisms?

Structure-function studies of T. auensis atpB can provide several important insights:

Proton Channel Architecture:

  • Site-directed mutagenesis of conserved residues in transmembrane helices can identify critical amino acids involved in proton translocation

  • Cross-linking studies with c-subunits can elucidate the interactions at the a/c interface

  • Molecular dynamics simulations based on structural data can reveal proton movement mechanisms

Ion Specificity Determinants:

  • Chimeric constructs combining domains from Na⁺-specific and H⁺-specific ATP synthases can identify specificity-determining regions

  • Comparative analysis with ATP synthases that can use either ΔpH or Δψ as driving forces can identify structural features that determine energy coupling preferences

Stator Function:

  • Investigations of interactions between atpB and other stator components (including b-subunits) can clarify the mechanism of preventing rotation of the a-subunit during c-ring rotation

  • Fluorescence resonance energy transfer (FRET) studies can measure distances between subunits during function

These studies would contribute to the broader understanding of ATP synthase as a molecular machine and potentially identify unique features of T. auensis ATP synthase related to its ecological adaptations.

What role might ATP synthase play in the unique metabolic capabilities of T. auensis?

T. auensis is notable for its ability to produce toluene from phenylalanine and other phenyl precursors . The ATP synthase likely plays several important roles in supporting this specialized metabolism:

Energy Coupling:

  • ATP synthesis provides energy for the activation and transformation of aromatic amino acids

  • The proton gradient utilized by ATP synthase may be generated partly through fermentation pathways that also relate to aromatic compound metabolism

Metabolic Flexibility:

pH Homeostasis:

  • The bidirectional function of ATP synthase (synthesis/hydrolysis) contributes to pH homeostasis

  • This may be particularly important during production of organic acids during fermentation

Research Approaches:

  • Metabolic flux analysis comparing wild-type and ATP synthase-inhibited T. auensis

  • Transcriptomic studies correlating ATP synthase gene expression with toluene production pathways

  • Comparative proteomics under different growth conditions to identify regulatory connections

How might T. auensis atpB be used as a model for studying bacterial adaptation to energy-limited environments?

T. auensis has adapted to grow in anoxic lake sediments , environments often characterized by energy limitation. Its ATP synthase represents an excellent model for studying bacterial energy adaptations:

Low Energy Threshold Studies:

  • Determine the minimum proton motive force required for ATP synthesis

  • Compare with other bacterial ATP synthases that have different threshold requirements (e.g., 87-150 mV as shown in Table 1)

Stoichiometric Efficiency:

  • Analyze the H⁺/ATP ratio of T. auensis ATP synthase

  • Investigate if T. auensis has evolved specific adaptations to maximize ATP yield per proton

Regulatory Mechanisms:

  • Study how T. auensis regulates ATP synthase expression under energy-limited conditions

  • Investigate potential inhibitory proteins similar to the MgtC described in search result

Environmental Simulation:

  • Reconstitute T. auensis ATP synthase in liposomes under varying conditions that mimic environmental stresses

  • Measure functional parameters like ATP synthesis rate and threshold driving force

This research could provide insights into bacterial energy conservation strategies in natural environments where energy sources are often limited or fluctuating.

What are common challenges in working with recombinant T. auensis atpB and how can they be addressed?

Researchers frequently encounter several challenges when working with membrane proteins like atpB:

Expression Challenges:

  • Low expression levels: Optimize codon usage, reduce expression temperature, try different E. coli strains

  • Toxicity to host cells: Use tight promoter control, glucose repression, or low copy number vectors

  • Inclusion body formation: Express at lower temperatures (16-25°C), co-express with chaperones

Purification Difficulties:

  • Poor solubilization: Test different detergents (DDM, LDAO, CHAPS) at various concentrations

  • Aggregation during purification: Include glycerol (10-15%) and ensure detergent is always present above CMC

  • Co-purifying contaminants: Include additional wash steps in IMAC, try different imidazole gradients

Stability Issues:

  • Rapid degradation: Add protease inhibitors, work quickly at 4°C, avoid freeze-thaw cycles

  • Activity loss during storage: Store in small aliquots with glycerol, test cryoprotectants, avoid multiple freeze-thaw cycles

Functional Reconstitution:

  • Inefficient liposome incorporation: Optimize lipid composition to match bacterial membranes

  • Incorrect orientation in liposomes: Use freeze-thaw cycles during reconstitution to randomize orientation

  • Poor activity in reconstituted systems: Ensure all necessary ATP synthase subunits are present

Table 2: Troubleshooting Guide for Common Issues with Recombinant atpB

IssuePossible CausesSolutions
No protein expressionToxicity, rare codons, improper inductionUse C41/C43 E. coli strains, codon optimization, lower IPTG concentration
Protein in inclusion bodiesRapid expression, improper foldingLower temperature (16-20°C), co-express with chaperones
Protein aggregation after purificationDetergent removal, concentration too highMaintain detergent above CMC, add lipids, optimize buffer conditions
No functional activityImproper folding, missing subunits, denaturationReconstitute with other ATP synthase subunits, optimize purification conditions

How can researchers interpret and troubleshoot contradictory results in ATP synthase activity assays?

When faced with contradictory results in ATP synthase activity assays, consider these methodological approaches:

Systematic Validation:

  • Check enzyme purity and integrity:

    • Ensure no proteolytic degradation by SDS-PAGE

    • Verify complex assembly by native gel electrophoresis

    • Confirm subunit composition by mass spectrometry

  • Validate assay components:

    • Use fresh reagents (ADP, Pi, ATP)

    • Include positive controls with well-characterized ATP synthases

    • Test different detection methods (e.g., luciferase, NADH-coupled assays, radioactive assays)

  • Examine reconstitution parameters:

    • Verify liposome integrity by dynamic light scattering

    • Ensure proper protein:lipid ratio

    • Confirm proton gradient formation using pH-sensitive dyes

Common Sources of Discrepancies:

  • Ion specificity: T. auensis ATP synthase may have different ion preferences (H⁺ vs. Na⁺)

  • Driving force components: Some ATP synthases require both ΔpH and Δψ, while others can use either alone

  • Inhibitory factors: Endogenous inhibitory proteins or lipids may co-purify with the complex

  • Orientation in liposomes: Mixed orientations can complicate interpretation of results

Data Analysis Approach:

  • Normalize activity to active enzyme concentration rather than total protein

  • Use initial rates rather than endpoint measurements

  • Perform kinetic analyses under varying conditions (ion concentrations, pH, membrane potential)

  • Compare relative activities rather than absolute values when comparing across experimental setups

What controls and standards should be included in experiments with T. auensis atpB?

Rigorous experimental design for T. auensis atpB studies should include these controls:

Protein Quality Controls:

  • Negative control: Heat-denatured protein preparation

  • Positive control: Well-characterized ATP synthase (e.g., E. coli F₁F₀-ATP synthase)

  • Purity control: SDS-PAGE and Western blot analysis of each preparation

Expression and Purification Controls:

  • Vector-only control: Cells transformed with empty vector processed identically

  • Tag-only control: Protein consisting of just the affinity tag to control for tag effects

  • Bioactivity standard: Commercial ATP synthase with known specific activity

Functional Assay Controls:

  • No-enzyme control: Complete reaction mixture without enzyme

  • No-substrate control: Omission of ADP or Pi for synthesis assays

  • Uncoupler control: Addition of protonophores (e.g., CCCP, TCS) to collapse proton gradient

  • Inhibitor controls: Oligomycin for F₀ inhibition, azide for F₁ inhibition

Reconstitution Controls:

  • Protein-free liposomes: To establish baseline leakage and background

  • Known orientation preparation: Using specific reconstitution protocols that favor single orientation

  • Inside-out vs. right-side-out preparations: To distinguish direction-dependent activities

Statistical Considerations:

  • Minimum of three biological replicates (separate protein preparations)

  • Three technical replicates for each measurement

  • Appropriate statistical tests for significance (e.g., t-test, ANOVA)

  • Inclusion of error bars representing standard deviation or standard error

How does the ATP synthase from T. auensis compare with homologs from other Gammaproteobacteria?

Comparative analysis of T. auensis ATP synthase with other Gammaproteobacteria reveals important evolutionary and functional insights:

Sequence Conservation:

  • The atpB gene shows typical conservation patterns of bacterial a-subunits, with highest homology in transmembrane regions involved in proton translocation

  • Based on its phylogenetic position, T. auensis ATP synthase likely shares higher sequence similarity with other members of Aeromonadaceae than with more distant Gammaproteobacteria

Structural Features:

  • The 259 amino acid sequence of T. auensis atpB contains the characteristic hydrophobic transmembrane helices typical of F₀ a-subunits

  • Like other bacterial ATP synthases, it likely forms a complex with multiple c-subunits in a rotor arrangement

  • The ion-binding sites likely follow the conserved pattern of other bacterial ATP synthases

Functional Comparisons:

  • The driving force requirements may be similar to those of E. coli (threshold ~150 mV) based on their phylogenetic relationship

  • Environmental adaptations may have influenced specific functional properties, as T. auensis inhabits freshwater lake sediments with potentially fluctuating oxygen conditions

Evolutionary Context:

  • As part of the Aeromonadaceae family, T. auensis represents an interesting branch of Gammaproteobacteria with unique metabolic capabilities

  • Comparing its ATP synthase with those from other species could provide insights into evolutionary adaptations related to energy metabolism in this family

What can be learned from comparing bacterial F-type ATP synthases with archaeal A/V-type ATP synthases?

Comparison between T. auensis F-type ATP synthase and archaeal A/V-type ATP synthases provides valuable evolutionary insights:

Structural Distinctions:

  • F-type ATP synthases (like in T. auensis) have different subunit composition compared to A/V-type ATP synthases

  • The c-subunit of F-type ATP synthases typically has a hairpin structure with one ion-binding site, while some archaeal ATP synthases have V-type c subunits with different architectures

Driving Force Requirements:

  • Some archaeal A₁A₀ ATP synthases can use either ΔpH or Δψ alone as driving forces for ATP synthesis

  • In contrast, many bacterial F₁F₀ ATP synthases (like E. coli) require both components

  • Threshold values for ATP synthesis differ significantly:

    • E. callanderi (archaeal): 87 mV

    • A. woodii (hybrid system): 90 mV

    • P. modestum (bacterial): 120 mV

    • E. coli (bacterial): 150 mV

Evolutionary Implications:

  • Despite structural differences, both types perform the same core function of ATP synthesis

  • Study of these systems provides insights into convergent evolution and ancient bioenergetic mechanisms

  • The ability of archaeal ATP synthases to synthesize ATP at lower driving forces may represent adaptation to energy-limited environments often inhabited by archaea

Research Applications:

  • Engineering hybrid ATP synthases with components from both systems could create enzymes with novel properties

  • Understanding ancient ATP synthases can inform the design of minimal synthetic systems for biotechnology applications

How might environmental adaptations influence the structure and function of T. auensis ATP synthase?

T. auensis was isolated from anoxic sediments of a freshwater lake , and its ATP synthase likely reflects adaptations to this environment:

Oxygen Fluctuation Adaptations:

  • T. auensis can grow under both oxic and anoxic conditions

  • Its ATP synthase may possess regulatory mechanisms allowing it to function efficiently under varying oxygen concentrations

  • Potential adaptations might include modified c-ring stoichiometry to optimize energy conversion under limiting conditions

pH and Ion Adaptations:

  • Freshwater environments can experience pH fluctuations

  • ATP synthase may have evolved specific ion preferences or pH optima matching the organism's habitat

  • The optimal pH for T. auensis growth is 7.2 , suggesting its ATP synthase may be optimized for near-neutral pH

Energy Efficiency Adaptations:

  • Lake sediments often represent energy-limited environments

  • The ATP synthase may have evolved towards higher efficiency (possibly through c-ring stoichiometry adjustments)

  • Regulatory mechanisms may exist to prevent wasteful ATP hydrolysis under energy-limited conditions

Temperature Adaptations:

  • T. auensis has an optimal growth temperature of 22°C

  • Its ATP synthase would likely show highest activity near this temperature

  • Structural features may include adaptations for flexibility and function at moderate temperatures

Research Directions:

  • Compare ATP synthase activity across temperature, pH, and ion concentration ranges

  • Analyze c-ring stoichiometry in relation to energy efficiency

  • Study regulatory mechanisms that may respond to environmental fluctuations

  • Investigate potential unique adaptations related to the organism's toluene-producing capability

How might CRISPR-Cas9 genome editing be applied to study ATP synthase function in T. auensis?

CRISPR-Cas9 genome editing offers powerful approaches for studying ATP synthase in T. auensis:

Gene Modification Strategies:

  • Knockout studies: Create atpB deletion mutants to assess essentiality and impacts on growth and metabolism

  • Point mutations: Introduce specific amino acid changes to study structure-function relationships

  • Domain swapping: Replace domains with those from other species to create chimeric proteins

  • Reporter fusions: Create fluorescent protein fusions to study localization and expression

Experimental Applications:

  • Investigate the relationship between ATP synthase function and toluene production

  • Study the impact of atpB mutations on growth under varying oxygen conditions

  • Explore potential interactions between ATP synthase and other metabolic pathways

  • Create conditional mutants to study essentiality under different growth conditions

Technical Considerations:

  • Development of efficient transformation protocols for T. auensis

  • Optimization of CRISPR-Cas9 systems for this specific organism

  • Design of appropriate homology-directed repair templates

  • Screening strategies for successful genome modifications

Potential Outcomes:

  • Identification of essential residues for ATP synthase function

  • Understanding of the relationship between energy metabolism and specialized metabolic pathways

  • Creation of strains with modified ATP synthesis properties for biotechnological applications

What novel biophysical techniques could advance our understanding of T. auensis ATP synthase structure and dynamics?

Several cutting-edge biophysical techniques offer promising approaches for studying T. auensis ATP synthase:

Advanced Structural Methods:

  • Cryo-electron microscopy (cryo-EM): Determine high-resolution structures of the complete ATP synthase complex in different conformational states

  • Single-particle analysis: Capture conformational heterogeneity and dynamic states

  • Cryo-electron tomography: Study ATP synthase in its native membrane environment

Dynamic Analysis Techniques:

  • Single-molecule FRET: Monitor conformational changes during catalytic cycle

  • High-speed atomic force microscopy (HS-AFM): Visualize rotation of the ATP synthase in real-time

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map conformational changes and protein dynamics

Functional Analysis Methods:

  • Patch-clamp of reconstituted systems: Directly measure proton translocation

  • Magnetic tweezers and beads: Study rotational mechanics and torque generation

  • Fluorescence correlation spectroscopy: Analyze binding kinetics of substrates and inhibitors

Computational Approaches:

  • Molecular dynamics simulations: Model proton movement through the a-subunit channel

  • Quantum mechanics/molecular mechanics (QM/MM): Study proton transfer at atomic resolution

  • Machine learning approaches: Predict structure-function relationships from sequence data

These advanced techniques would provide unprecedented insights into the molecular mechanisms of ATP synthesis in T. auensis and potentially reveal unique adaptations related to its environmental niche.

How can systems biology approaches integrate ATP synthase function with broader metabolic networks in T. auensis?

Systems biology offers powerful frameworks for understanding ATP synthase within the broader context of T. auensis metabolism:

Multi-Omics Integration:

  • Genomics: Analyze the genetic context of ATP synthase genes within the 3.47 Mb genome

  • Transcriptomics: Study co-expression patterns with other metabolic genes under various conditions

  • Proteomics: Quantify ATP synthase abundance relative to other energy-generating systems

  • Metabolomics: Correlate ATP levels with metabolic fluxes throughout the network

  • Fluxomics: Measure carbon and energy flow through central metabolism

Network Analysis:

  • Construct genome-scale metabolic models incorporating ATP synthesis and consumption

  • Identify synthetic lethal interactions with ATP synthase through computational predictions

  • Model energy balance under different growth conditions (oxic/anoxic)

  • Predict metabolic responses to ATP synthase inhibition or modification

Experimental Validation Approaches:

  • Growth phenotyping under various nutrient and oxygen conditions

  • Metabolic flux analysis using stable isotope labeling

  • Protein-protein interaction studies to identify regulatory partners

  • Genetic interaction screens to map functional relationships

Integration with Unique Metabolic Capabilities:

  • Model the energetic requirements of toluene production from phenylalanine

  • Investigate ATP-dependent steps in aromatic compound metabolism

  • Explore energy conservation strategies under anoxic growth conditions

  • Compare with other members of Aeromonadaceae family to identify unique aspects

This systems-level understanding would place ATP synthase function in its proper cellular context and potentially reveal novel regulatory mechanisms and metabolic relationships specific to T. auensis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.