Recombinant Tolumonas auensis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

PlsY is encoded by the plsY gene (locus tag: Tola_2667) in Tolumonas auensis DSM 9187/TA4. Key features include:

Functional Role in Lipid Metabolism

PlsY initiates the de novo synthesis of glycerolipids by acylating glycerol-3-phosphate (G3P) to form LPA, a precursor for phosphatidic acid (PA) and triglycerides (TG) . In T. auensis, this enzyme may contribute to membrane lipid assembly under varying environmental conditions, though its direct role in the organism’s unique toluene production remains uncharacterized .

Mechanistic Insights

  • Substrate Specificity: Prefers acyl-phosphate donors over acyl-CoA, distinguishing it from canonical GPATs .

  • Biological Context: Homologs in related bacteria (e.g., Aurantiochytrium limacinum) are implicated in polyunsaturated fatty acid incorporation into complex lipids, suggesting PlsY may influence lipid diversity .

Research Applications

Recombinant PlsY is primarily utilized in:

  1. Enzyme Kinetics Studies: To elucidate substrate preferences and inhibition mechanisms.

  2. Structural Biology: Crystallization efforts to resolve its acyltransferase domain architecture.

  3. Industrial Biotechnology: Potential use in engineered lipid biosynthesis pathways for biofuel or specialty lipid production.

Technical Considerations

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquoting is advised .

  • Activity Assays: Requires optimization of phosphate donors (e.g., acyl-phosphates) and divalent cations.

  • Cross-Reactivity: Antibodies against PlsY may show specificity challenges due to conserved GPAT motifs .

Evolutionary and Genomic Context

  • Taxonomic Classification: T. auensis belongs to the Aeromonadaceae family (γ-Proteobacteria) and is genetically distinct from Escherichia or Yersinia .

  • Genomic Insights: The plsY gene is part of a conserved operon linked to lipid metabolism, adjacent to genes encoding phosphate acyltransferases .

Future Directions

  1. Mechanistic Studies: Resolve catalytic residues and regulatory domains via mutagenesis.

  2. Biotechnological Engineering: Optimize PlsY for high-yield LPA synthesis in industrial microbes.

  3. Ecological Impact: Investigate PlsY’s role in T. auensis’s adaptation to anoxic freshwater sediments .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us beforehand. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) is recommended and aliquoting for long-term storage at -20°C/-80°C is advisable. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
plsY; Tola_2667; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Tolumonas auensis (strain DSM 9187 / TA4)
Target Names
plsY
Target Protein Sequence
MLALTFAMSGIAYLLGSVSNAVLISRLCDLPDPREYGSHNPGATNVLRSGNRLAALIVFL LDMLKGTIPVYLAWYLGIPPLYLGFIGIAACLGHMYPLYFHFRGGKGVATALGALLPLGL DMGSFMIVTWLIVLLFTGYSSLAAIGAALLAPLYTYCLKPEYTLPVAMLCCLIILRHHEN ISRLLQGHEPQVWSRHPLKRHRR
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Tolumonas auensis and why is its PlsY enzyme of research interest?

Tolumonas auensis is currently the only validly named species of the genus Tolumonas in the family Aeromonadaceae. This bacterium has gained scientific interest primarily due to its unique metabolic capabilities, including the production of toluene from phenylalanine and other phenyl precursors, as well as phenol from tyrosine . The PlsY enzyme (glycerol-3-phosphate acyltransferase) from T. auensis is of particular interest because glycerol-3-phosphate acyltransferases play crucial roles in lipid biosynthesis, catalyzing the first step in phospholipid biosynthesis by transferring acyl groups to the sn-1 position of glycerol-3-phosphate. Studies of similar enzymes in other organisms have demonstrated their importance in membrane formation and fatty acid incorporation into glycerolipids .

What genomic resources are available for Tolumonas auensis PlsY research?

The complete genome sequence of Tolumonas auensis type strain (TA 4T) has been fully sequenced and is publicly available. The genome consists of a 3,471,292 bp chromosome with a total of 3,288 protein-coding genes and 116 RNA genes . This genomic data was sequenced as part of the DOE Joint Genome Institute Program JBEI 2008, making it possible to identify and study genes involved in lipid metabolism, including those encoding for glycerol-3-phosphate acyltransferases. Researchers can utilize this genomic information to design primers for gene amplification and develop recombinant expression strategies.

What are the optimal expression systems for recombinant T. auensis PlsY and what challenges might researchers encounter?

Based on experiences with similar bacterial enzymes, E. coli expression systems (particularly BL21(DE3) or its derivatives) offer a reliable starting point for recombinant PlsY expression. Key challenges researchers should anticipate include:

  • Protein solubility issues - As a membrane-associated enzyme, PlsY may form inclusion bodies in recombinant systems, necessitating optimization of induction conditions (lower temperatures of 16-20°C, reduced IPTG concentrations, or co-expression with chaperones).

  • Proper folding considerations - The native environment of T. auensis is quite specific (anoxic sediments, optimal growth at 22°C) , which may affect protein folding in standard expression systems.

  • Enzyme activity preservation - Special attention should be paid to preserving the structure-function relationship during purification, potentially requiring detergent screening to maintain activity.

Alternative expression systems worth considering include Bacillus subtilis or cell-free expression systems when working with membrane-associated proteins like glycerol-3-phosphate acyltransferases.

How might the unique metabolism of T. auensis influence the functional characteristics of its PlsY?

T. auensis possesses the unusual ability to produce toluene from phenylalanine and phenol from tyrosine , indicating a specialized aromatic amino acid metabolism. This metabolic uniqueness might potentially influence its lipid metabolism pathways as well. Research questions to investigate include:

  • Does T. auensis PlsY exhibit substrate preferences that reflect its natural habitat (anoxic lake sediments)?

  • Has the enzyme evolved properties that function optimally under low-oxygen, mesophilic conditions (12-25°C range with optimal activity at 22°C) ?

  • Are there structural adaptations in T. auensis PlsY that might relate to its evolutionary position within the Aeromonadaceae family?

Comparative analysis with glycerol-3-phosphate acyltransferases from related species could provide insights into these questions.

What structural domains of T. auensis PlsY are critical for substrate specificity and catalytic activity?

While specific structural data for T. auensis PlsY is not directly available in the provided literature, insights can be drawn from studies of PLAT2 in Aurantiochytrium limacinum, which functions as a glycerol-3-phosphate acyltransferase with specificity for docosahexaenoic acid (DHA) . Key structural questions for investigation include:

  • Does T. auensis PlsY contain conserved acyltransferase motifs (HX4D) found in other bacterial glycerol-3-phosphate acyltransferases?

  • What residues form the binding pocket for glycerol-3-phosphate, and how do they compare with those in other bacterial species?

  • Are there unique structural features that might be related to T. auensis' adaptation to anoxic environments?

Site-directed mutagenesis experiments targeting conserved residues would be valuable for identifying structure-function relationships.

What is the recommended protocol for cloning and expressing recombinant T. auensis PlsY while maintaining enzymatic activity?

A methodological approach for successful cloning and expression involves:

  • Gene Amplification and Cloning:

    • Design primers based on the genome sequence of T. auensis (TA 4T) , incorporating appropriate restriction sites.

    • Optimize PCR conditions considering the GC content of the target gene.

    • Clone into an expression vector with an appropriate tag (His6, MBP, or SUMO) to aid purification and potentially enhance solubility.

  • Expression Optimization:

    • Test multiple expression conditions in E. coli (BL21(DE3) or Rosetta strains).

    • Recommended induction parameters: 0.1-0.5 mM IPTG at lower temperatures (16-22°C) for 16-20 hours.

    • Consider autoinduction media to produce gentler expression profiles.

  • Purification Strategy:

    • Use a two-step purification process combining affinity chromatography and size exclusion.

    • Include glycerol (10-20%) and reducing agents in all buffers.

    • Consider mild detergents (0.05-0.1% DDM or CHAPS) to maintain enzyme stability if membrane-associated.

  • Activity Preservation:

    • Analyze enzyme activity immediately after purification.

    • Optimize storage conditions with stabilizing agents (glycerol, reducing agents).

What assay systems are most suitable for characterizing the enzymatic activity of recombinant T. auensis PlsY?

Effective assay systems for characterizing PlsY activity include:

  • Radiometric Assay:

    • Utilize [14C]-labeled glycerol-3-phosphate and various acyl-CoA substrates.

    • Monitor incorporation of radioactivity into lysophosphatidic acid.

    • Advantages: High sensitivity and specificity.

  • Coupled Enzymatic Assay:

    • Measure CoA release through a coupled reaction with 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB).

    • Monitor absorbance change at 412 nm.

    • Advantages: Continuous monitoring of reaction kinetics.

  • LC-MS/MS Analysis:

    • Directly quantify lysophosphatidic acid formation using liquid chromatography-tandem mass spectrometry.

    • Advantages: Can identify product structures and monitor multiple products simultaneously.

When studying substrate preferences, it's advisable to test a range of acyl-CoA substrates with varying chain lengths and saturation levels, as observed studies with PLAT2 showed specific preferences for certain fatty acids like DHA .

How can researchers effectively analyze the substrate specificity of T. auensis PlsY?

A comprehensive approach to analyzing substrate specificity includes:

  • Substrate Panel Testing:

    • Prepare a diverse panel of acyl-CoA donors (varying in chain length, saturation, and functional groups).

    • Systematically test each substrate under standardized conditions.

    • Calculate relative activities and kinetic parameters (Km, Vmax, kcat).

  • Competition Assays:

    • Perform assays with mixtures of acyl-CoA substrates to determine preferential incorporation.

    • Analyze products using LC-MS/MS to quantify relative utilization.

  • Structure-Function Analysis:

    • Correlate observed substrate preferences with structural features through molecular modeling.

    • Consider potential evolutionary adaptations related to T. auensis' natural habitat in anoxic lake sediments .

  • Comparison with Related Enzymes:

    • Compare substrate utilization patterns with those of glycerol-3-phosphate acyltransferases from related species within the Aeromonadaceae family.

How should researchers interpret kinetic data for T. auensis PlsY in the context of its native biological function?

When analyzing kinetic data for T. auensis PlsY, consider the following interpretative framework:

  • Contextual Analysis:

    • Compare kinetic parameters (Km, kcat, kcat/Km) with those of glycerol-3-phosphate acyltransferases from related organisms.

    • Consider how kinetic properties align with T. auensis' growth conditions (temperature optimum of 22°C, anoxic environment) .

  • Substrate Preference Interpretation:

    • Evaluate whether substrate preferences reflect the fatty acid composition likely available in T. auensis' native environment.

    • Consider whether there's correlation between preferred substrates and the membrane lipid composition of the organism.

  • Physiological Relevance Assessment:

    • Determine if the enzyme operates at substrate concentrations likely to be physiologically relevant.

    • Consider whether kinetic parameters support the enzyme's proposed role in phospholipid biosynthesis.

  • Phylogenetic Context:

    • Interpret findings in the context of T. auensis' phylogenetic position within the Aeromonadaceae family .

    • Consider whether observed properties reflect conserved features or specialized adaptations.

What are the potential pitfalls in interpreting recombinant enzyme activity versus native functionality?

Researchers should be aware of several potential discrepancies when comparing recombinant T. auensis PlsY activity with its native functionality:

  • Expression System Effects:

    • Recombinant proteins expressed in E. coli may lack post-translational modifications present in the native host.

    • Protein folding may differ in heterologous expression systems, affecting activity.

  • Membrane Environment Considerations:

    • As a likely membrane-associated enzyme, PlsY activity in vitro may differ significantly from its activity in the native membrane environment.

    • The lipid composition of T. auensis membranes (which has adapted to anoxic conditions) may influence enzyme activity in ways difficult to replicate in vitro.

  • Substrate Availability Differences:

    • In vitro assays typically use high substrate concentrations that may not reflect physiological conditions.

    • The availability of specific acyl-CoA donors in T. auensis may differ from those commonly used in laboratory assays.

  • Interaction Partners:

    • Potential protein-protein interactions that modulate activity in vivo may be absent in recombinant systems.

    • Consider whether PlsY functions as part of a larger complex in its native context.

How can contradictory findings in T. auensis PlsY research be reconciled through experimental design?

When confronted with contradictory findings regarding T. auensis PlsY:

  • Methodological Reconciliation:

    • Systematically compare experimental conditions across studies (buffer composition, pH, temperature, substrate concentrations).

    • Implement standardized protocols that more closely mimic T. auensis' native conditions (22°C optimum, anaerobic environment) .

  • Expression System Evaluation:

    • Compare enzyme properties across different expression systems (E. coli, B. subtilis, cell-free systems).

    • Consider whether fusion tags or purification methods affect enzyme behavior.

  • Contextual Analysis:

    • Investigate whether apparent contradictions reflect different aspects of enzyme function rather than true discrepancies.

    • Consider whether environmental factors (oxygen levels, ion concentrations) might explain seemingly contradictory results.

  • Comprehensive Characterization:

    • Design experiments that test enzyme function under a broader range of conditions.

    • Consider time-resolved studies to capture potential conformational changes or regulatory mechanisms.

What are promising approaches for engineering T. auensis PlsY for improved functionality or novel applications?

Several promising engineering approaches include:

  • Rational Design Strategies:

    • Target residues involved in substrate binding to alter specificity.

    • Engineer the enzyme for enhanced thermostability while maintaining its unique properties derived from its mesophilic nature (optimal at 22°C) .

    • Modify residues to improve solubility and expression yields while preserving catalytic function.

  • Directed Evolution Approaches:

    • Implement error-prone PCR to generate libraries of PlsY variants.

    • Develop high-throughput screening methods to identify variants with desired properties (broader substrate range, enhanced stability).

    • Use computational tools to guide semi-rational approaches combining insight-driven mutations with directed evolution.

  • Chimeric Enzyme Development:

    • Create fusion proteins incorporating domains from glycerol-3-phosphate acyltransferases with complementary properties.

    • Explore domain swapping with related enzymes from the Aeromonadaceae family to understand structure-function relationships.

  • Application-Specific Modifications:

    • Engineer variants optimized for the production of specific lysophosphatidic acids or more complex lipids.

    • Consider modifications that would enhance the enzyme's utility in in vitro lipid synthesis applications.

How might systems biology approaches enhance our understanding of T. auensis PlsY in cellular metabolism?

Integrative systems biology approaches offer several avenues to better understand PlsY's role:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.