Recombinant Tolumonas auensis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Overview

Tolumonas auensis is a Gram-negative, rod-shaped bacterium that can grow under both aerobic and anaerobic conditions . It has been studied for its ability to produce toluene from phenylalanine and other phenyl precursors .

Recombinant Tolumonas auensis Large-conductance mechanosensitive channel (MscL) is a bacterial mechanosensitive channel. Mechanosensitive (MS) channels act as safety valves, protecting cells from extreme pressures caused by acute changes in environmental osmolarity . MS channels are membrane-embedded proteins that, when open, allow the free diffusion of osmolytes (salts) across the cytoplasmic membrane .

Tolumonas auensis

Tolumonas auensis is a bacterium isolated from anoxic sediments of a freshwater lake . The cells are nonmotile, Gram-negative rods, with dimensions of 0.9 to 1.2 by 2.5 to 3.2 microns . The optimum temperature and pH for its growth are 22°C and pH 7.2, respectively . The G+C content of its DNA is 49 mol% . Tolumonas auensis produces toluene from phenylalanine, phenylpyruvate, phenyllactate, and phenylacetate, and phenol from tyrosine . Both a carbon source and a toluene precursor are essential for initiating toluene production . The major lipoquinones are ubiquinone 8 and menaquinone 8 under both oxic and anoxic growth conditions .

Scientific Classification

  • Domain: Bacteria

  • Kingdom: Pseudomonadati

  • Phylum: Pseudomonadota

  • Class: Gammaproteobacteria

  • Order: Aeromonadales

  • Family: Aeromonadaceae

  • Genus: Tolumonas

  • Species: T. auensis

Mechanosensitive Channels

Mechanosensitive (MS) channels are crucial for protecting the cytoplasmic membrane of living cells from environmental changes in osmolarity . These channels are membrane-embedded proteins that permit the free diffusion of osmolytes across the cytoplasmic membrane when open .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; Tola_1283; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Tolumonas auensis (strain DSM 9187 / TA4)
Target Names
mscL
Target Protein Sequence
MLGEFKKFAMRGNVVDMAVGIVIGAAFGSIVKSLVDDVLMPPIGLLLGGVDFSDFFVVLK EGVKAAAPYQTLAEAKAAGAVTLNFGLFVNAIISFTIVAFALFMIVKAMNKLRADEEVKP VTTKKCPHCCSEIALEATRCPHCTSEL
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Tolumonas auensis and why is its mscL channel of interest to researchers?

Tolumonas auensis is a gram-negative, rod-shaped bacterium originally isolated from anoxic sediments of freshwater lakes. It has unique metabolic capabilities, including the production of toluene from aromatic amino acids and related compounds . The large-conductance mechanosensitive channel (mscL) from this organism is of particular interest because mechanosensitive channels serve as emergency release valves during osmotic downshock, protecting bacteria from lysis. T. auensis' ability to thrive in both oxic and anoxic conditions suggests its mscL may have adapted unique properties for environmental versatility .

What are the optimal growth conditions for Tolumonas auensis?

Tolumonas auensis grows optimally at 22°C and pH 7.2. It is a facultative anaerobe, capable of growth under both oxic and anoxic conditions. The organism has a DNA G+C content of 49 mol%. When cultured on glucose under anaerobic conditions, its major fermentation products include acetate, ethanol, and formate. The bacterium is characterized by nonmotile, gram-negative rods measuring 0.9 to 1.2 by 2.5 to 3.2 microns .

How does the mscL channel function in bacterial osmoregulation?

The large-conductance mechanosensitive channel functions as a pressure-sensitive "emergency release valve" that opens in response to increased membrane tension during hypoosmotic shock. When bacteria experience sudden decreases in environmental osmolarity, water influx causes membrane stretching, which triggers mscL to form a large pore allowing rapid efflux of cytoplasmic solutes. This mechanism prevents cell lysis by reducing turgor pressure. In T. auensis, which inhabits variable freshwater environments, this channel likely plays a crucial role in adaptation to changing osmotic conditions.

Which expression systems are most effective for recombinant production of T. auensis mscL?

For T. auensis mscL expression, several systems can be employed with varying advantages. Based on approaches similar to those used for other membrane proteins, expression in E. coli using specialized vectors (pET series, pBAD) offers high yield and straightforward protocols. For more complex folding requirements, the methylotrophic yeast Pichia pastoris shows promise, as demonstrated with other membrane proteins and antimicrobial peptides . When selecting an expression system, researchers should consider:

  • Codon optimization for the host organism

  • Inclusion of appropriate fusion tags (His, GST, MBP) for detection and purification

  • Inducible promoter systems for controlled expression

  • Growth conditions that minimize toxicity of overexpressed membrane proteins

What purification strategies yield the highest quality recombinant mscL protein?

Effective purification of recombinant T. auensis mscL typically involves:

  • Membrane fraction isolation via differential centrifugation

  • Solubilization using mild detergents (DDM, LDAO, or OG)

  • Immobilized metal affinity chromatography (IMAC) utilizing His-tags

  • Size exclusion chromatography for oligomeric state verification

  • Optionally, reconstitution into liposomes or nanodiscs for functional studies

The critical step is detergent selection, which must maintain the pentameric state of mscL while efficiently extracting it from membranes. Protein quality should be assessed via SDS-PAGE, Western blotting, and dynamic light scattering to verify purity and homogeneity before functional characterization.

How should codon optimization be approached for T. auensis genes in heterologous expression systems?

Codon optimization for T. auensis genes should account for the 49 mol% G+C content of its genome and the codon usage bias of the selected host. For expression in E. coli, optimization should focus on rare codons, particularly those encoding arginine, leucine, isoleucine, and proline. Software like GeneArt GeneOptimizer can be employed, similar to the approach used for other recombinant proteins . Additionally, researchers should:

  • Remove potential internal Shine-Dalgarno sequences

  • Eliminate problematic mRNA secondary structures

  • Adjust GC content in regions prone to stalling

  • Consider harmonization rather than maximization of codon adaptation index for membrane proteins

What electrophysiological methods are most appropriate for characterizing T. auensis mscL?

Patch-clamp electrophysiology represents the gold standard for functional characterization of mscL channels. For T. auensis mscL, researchers should consider:

  • Giant spheroplast patch-clamp for native-like membrane environment

  • Reconstituted proteoliposome patch-clamp for controlled lipid composition

  • Planar lipid bilayer recordings for larger sample throughput

Key parameters to measure include:

  • Single-channel conductance (typically 2-3 nS for bacterial mscL channels)

  • Pressure threshold for activation (negative pressure required to initiate gating)

  • Subconductance states during gating transitions

  • Open probability as a function of membrane tension

  • Channel kinetics (open and closed dwell times)

How can researchers design definitive experiments to compare wild-type and mutant mscL channels?

Robust experimental design for comparing mscL variants should include:

  • Parallel expression and purification using identical protocols

  • Verification of equal protein incorporation into liposomes

  • Standardized membrane composition across all samples

  • Multiple independent preparations to establish reproducibility

  • Systematic pressure protocols with defined increments

  • Complementary approaches (electrophysiology and fluorescence-based assays)

  • In vivo functional complementation in mscL-null bacterial strains

Statistical analysis should include normality testing, application of appropriate parametric or non-parametric comparisons, and clear reporting of sample sizes and variability measures.

What in vivo assays can assess the physiological function of recombinant T. auensis mscL?

Several in vivo approaches can verify physiological function:

  • Osmotic downshock survival assays comparing mscL-null strains complemented with T. auensis mscL versus controls

  • Growth inhibition analysis under hypoosmotic conditions

  • Fluorescent reporter release assays measuring cytoplasmic content release

  • Propidium iodide uptake measurements following hypoosmotic stress

  • FRET-based tension sensors coupled to mscL to measure activation in living cells

These methods provide physiologically relevant data complementing in vitro biophysical characterization.

What structural biology techniques are most informative for studying T. auensis mscL gating mechanisms?

Multiple structural approaches can illuminate mscL gating:

  • Cryo-electron microscopy (cryo-EM) to resolve different conformational states

  • X-ray crystallography for high-resolution static structures

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy to track movement of specific residues during gating

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify flexible regions

  • Molecular dynamics simulations to model channel behavior under membrane tension

Integrating these approaches can provide comprehensive understanding of how mechanical force translates to channel opening in T. auensis mscL.

How can researchers effectively use site-directed mutagenesis to probe structure-function relationships in T. auensis mscL?

Strategic mutagenesis should target:

  • Conserved transmembrane residues thought to form the channel gate

  • Periplasmic loops potentially involved in tension sensing

  • Cytoplasmic regions that may regulate channel activity

  • Hydrophobic residues at protein-lipid interfaces

  • Residues unique to T. auensis mscL compared to well-characterized homologs

Each mutation should be characterized by multiple functional assays, and results interpreted in the context of existing structural models and evolutionary conservation patterns.

What computational approaches complement experimental studies of T. auensis mscL?

Computational methods provide valuable insights when properly integrated with experimental data:

  • Homology modeling based on known mscL structures

  • Molecular dynamics simulations of channel behavior in membranes under tension

  • Coarse-grained simulations for longer timescale events

  • Bioinformatic analysis of sequence conservation across bacterial mscL homologs

  • Machine learning approaches to predict functional impacts of mutations

These approaches can guide experimental design and help interpret unexpected functional outcomes.

How can T. auensis mscL be utilized in biosensor development?

T. auensis mscL offers several advantages for biosensor applications:

  • Engineered gain-of-function mutations can create channels with tunable tension sensitivity

  • Reporter molecules can be released upon channel activation

  • Electrical conductance changes provide direct readout of channel activity

  • The channel can be incorporated into artificial membranes for device construction

  • Its function under both aerobic and anaerobic conditions enables versatile applications

For optimal biosensor development, researchers should focus on:

  • Stability optimization for ambient conditions

  • Signal amplification strategies

  • Interface development between biological components and electronic detection systems

  • Encapsulation methods for extended shelf-life

What considerations are important when designing experiments to compare mscL channels from T. auensis with those from other bacterial species?

Comparative studies should address:

  • Phylogenetic relationship between the species being compared

  • Environmental adaptations that might influence channel properties

  • Standardization of expression, purification, and measurement conditions

  • Matched lipid compositions relevant to native membranes

  • Parallel functional assays including both electrophysiology and in vivo tests

Creating chimeric channels by domain swapping between T. auensis mscL and other bacterial homologs can help identify regions responsible for functional differences.

How might T. auensis mscL be utilized in synthetic biology applications?

T. auensis mscL offers unique properties for synthetic biology:

  • As a genetically encodable pressure-sensitive release valve

  • For creating cells with programmable lysis thresholds

  • As a tension-controlled gateway for molecular cargo delivery

  • In engineered cells with mechanically triggered metabolic pathways

  • For developing bacteria with enhanced tolerance to osmotic fluctuations

The dual aerobic/anaerobic functionality of T. auensis makes its mscL particularly valuable for environmental applications where oxygen levels may vary .

What are common challenges in functional reconstitution of T. auensis mscL and how can they be addressed?

Several challenges frequently arise during reconstitution:

  • Poor incorporation efficiency

    • Solution: Optimize protein:lipid ratios and detergent removal methods

  • Loss of function during purification

    • Solution: Screen multiple detergents; include lipids during purification

  • Variable patch-clamp success rates

    • Solution: Standardize liposome size; ensure complete detergent removal

  • Non-specific leakage from liposomes

    • Solution: Verify protein purity; optimize reconstitution protocols

  • Inconsistent pressure-response relationships

    • Solution: Calibrate pressure application systems; standardize patch geometry

How can researchers resolve contradictory results between different functional assays of T. auensis mscL?

When facing contradictory results:

  • Verify protein quality and oligomeric state using size exclusion chromatography

  • Examine lipid composition effects systematically

  • Consider differences in timescales between assays (milliseconds for electrophysiology vs. minutes for cell survival)

  • Test for potential experimental artifacts with appropriate controls

  • Determine if differences reflect true biological complexity rather than experimental error

Combining multiple orthogonal approaches provides the most robust characterization.

What strategies can improve reproducibility in T. auensis mscL research across different laboratories?

To enhance reproducibility:

  • Develop standardized expression constructs available to the research community

  • Establish detailed protocols for protein purification with quality control metrics

  • Define standard lipid mixtures for functional reconstitution

  • Create calibrated pressure application systems for patch-clamp studies

  • Implement comprehensive data reporting including all experimental parameters

  • Use consistent terminology for describing channel properties

Table 1: Comparison of Expression Systems for Recombinant T. auensis mscL

Expression SystemAdvantagesDisadvantagesTypical YieldBest Applications
E. coliHigh yield, Simple protocols, Low costInclusion body risk, Limited PTMs1-5 mg/LInitial characterization, Structural studies
Pichia pastorisProper folding, Higher stability, Growth to high densityLonger expression time, More complex protocols0.5-2 mg/LFunctional studies requiring native folding
Cell-free systemsRapid expression, Direct incorporation into liposomesHigher cost, Lower scalability0.1-0.5 mg/mg mRNADifficult variants, Rapid screening
Mammalian cellsNative-like membranes, Complete PTMsLow yield, Complex protocols, Expensive0.1-0.5 mg/LInteraction studies with eukaryotic components

Table 2: Key Methods for Functional Analysis of T. auensis mscL

MethodPrimary Data ObtainedAdvantagesLimitationsRequired Equipment
Patch-clamp electrophysiologySingle channel conductance, Gating threshold, KineticsSingle molecule resolution, Direct measurementTechnical complexity, Low throughputPatch-clamp amplifier, Micromanipulators
Fluorescence efflux assaysPopulation channel activity, Comparative gatingHigher throughput, Simpler setupNo single channel data, Indirect measurementFluorescence plate reader
Osmotic shock survivalIn vivo functionalityPhysiologically relevantQualitative results, Complex interpretationStandard microbiology equipment
Stopped-flow spectroscopyChannel opening kineticsMillisecond resolutionNo single channel dataStopped-flow apparatus
Molecular dynamics simulationsStructural dynamics, EnergeticsAtomic-level detailRequires validation, Computationally intensiveHigh-performance computing

Table 3: Critical Mutations for Studying T. auensis mscL Function

RegionExample MutationsExpected Functional EffectExperimental ReadoutResearch Applications
TM1 helixG22S, V23D, F78NGain-of-function, Reduced gating thresholdSpontaneous activity, Lower pressure thresholdGating mechanism studies, Biosensor development
TM2 helixL96K, I100NAltered channel kineticsChanged open dwell timeStructure-function relationships
Periplasmic loopΔ40-50, R45EModified tension sensingChanged activation curve steepnessUnderstanding tension transduction
C-terminal domainTruncations, K120DAltered channel regulationChanged conductance propertiesRegulatory mechanism studies
Protein-lipid interfaceF93W, I96WModified lipid sensingAltered lipid dependenceMembrane interaction studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.