Recombinant Tolumonas auensis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Tolumonas auensis YidC

Product Identification

  • UniProt ID: C4LDZ4

  • Source Organism: Tolumonas auensis (strain DSM 9187/TA4)

  • Expression System: Baculovirus (insect cell-based)

  • Tag: Undisclosed (determined during manufacturing)

Key Features

  • Purity: >85% (verified by SDS-PAGE)

  • Formats: Lyophilized or liquid

  • Storage:

    • Lyophilized: 12 months at -20°C/-80°C

    • Liquid: 6 months at -20°C/-80°C

  • Reconstitution: Recommended in deionized sterile water with 5–50% glycerol for stability .

Production and Quality Control

Expression and Purification

ParameterDetail
Expression HostBaculovirus-infected insect cells
Tag TypeUndisclosed (varies by batch)
Purification MethodAffinity chromatography (specific resin undisclosed)
YieldNot specified; typical yields for baculovirus systems range 1–5 mg/L

Stability Testing

  • Repeated freeze-thaw cycles are discouraged .

  • Working aliquots stored at 4°C remain stable for ≤1 week .

Functional Applications

Research Use Cases

  1. In Vitro Membrane Insertion Assays: Reconstituted YidC facilitates Sec-independent insertion of substrates like F0c and M13 procoat .

  2. Structural Studies: Cryo-EM and molecular dynamics (MD) simulations to map ribosome-YidC interactions .

  3. Interaction Mapping: Identifying co-factors (e.g., YibN) that modulate YidC activity .

Validation Data

  • Activity Assays: Demonstrated stimulation of substrate insertion (1.5–1.8-fold) in inverted membrane vesicles (INVs) .

  • Crosslinking: TM1 helix implicated in SecYEG translocon collaboration .

Comparative Analysis with Other YidC Orthologs

FeatureT. auensis YidCE. coli YidCB. halodurans YidC
Expression SystemBaculovirusNative membrane vesiclesRecombinant (E. coli)
Key Structural MotifTM3–TM5 hydrophobic grooveTM1–SecY interaction domainConserved R72/R366 residues
Substrate SpecificityBroad (e.g., F0c, Pf3)Sec-dependent and -independentSec-independent

Limitations and Research Gaps

  • Structural Data: No high-resolution structure of T. auensis YidC is available; current models rely on homologs .

  • Functional Redundancy: Overlap with Sec translocon complicates in vivo validation .

  • Thermostability: Uncharacterized for T. auensis YidC, unlike thermophilic homologs (e.g., Thermotoga maritima) .

Future Directions

  • Cryo-EM Studies: To resolve the ribosome-YidC interface in T. auensis.

  • Proteomic Screens: Identify novel substrates using crosslinking-MS .

  • Biotechnological Adaptation: Engineered YidC variants for synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; Tola_3167; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Tolumonas auensis (strain DSM 9187 / TA4)
Target Names
yidC
Target Protein Sequence
MQPQRNLLLIGLLLVSFMLWQSWMVDKAPKTATPATAESSVPASSGGDVPNQNDASNAKH ALLTLRSDVLELTVDTLGGDIVEAKLLKQTEAQGSDKPFVLLEKKPQRQYIAQSGLIGRD GVDNQAERPVYTANGTEFALVEGKDELVVPMTFTDAKGNVFTKRFVLKRESYAVGVDYQV KNVSAQPLEIQFYGQLKQTIAAPEGSSTPGMMASAFHGAAYSSAEQRYEKVNFSDIGETK LDVATQAGWAGMLQHYFVTAWTGKADAQNHIYGKAVSVNADVKDSGEAIIGIKLPLTTIA ANSEAVVGTSLWIGPKLQDQMAAVAQHLDLTVDYGYLWFIAQPLFQLLQFLHGLVGNWGV AIILITMIVRGVMYPLSKAQYTSMAKMRLLQPKLTALRERLGDDRQKMSQAMMELYKEEK VNPLGGCFPLLIQMPIFIALYWTLMESVELRHAPFALWLTDLSVKDPYYVLPLLMGATMW YIQKMSPTTVTDPMQQKVMQFMPIVFTFMFLWFPSGLTLYWVVSNIVTIIQQTLIFRQLE KKGLHSRKK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It facilitates the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Furthermore, it assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in bacterial cells?

YidC is a bacterial membrane protein insertase that plays a critical role in the integration of membrane proteins into the lipid bilayer. It is evolutionarily related to the mitochondrial Oxa1p and the chloroplast Alb3 protein . The primary function of YidC is to facilitate the insertion and proper folding of newly synthesized membrane proteins, particularly those that do not require the classical Sec machinery (Sec-independent pathway) .

YidC acts enzymatically to catalyze membrane insertion, functioning as a membrane chaperone that supports folding reactions within the membrane bilayer . It provides an amphiphilic surface within the membrane that allows the transfer of polar regions of proteins through the lipid phase, while also interacting with the hydrophobic parts of substrate proteins . This dual functionality enables YidC to efficiently translocate hydrophilic domains of proteins across the membrane while facilitating the proper orientation of transmembrane segments.

Which protein substrates are known to depend on YidC for membrane insertion?

Several membrane proteins have been identified as YidC substrates, with the most well-characterized examples including:

  • M13 procoat protein fused to the soluble domain of leader peptidase (PC-Lep)

  • Pf3 coat protein, also fused to leader peptidase (Pf3-23Lep)

  • F0c subunit of the F1-F0 ATP synthase

  • SecG, a component of the Sec translocon (shows YidC-dependent biogenesis)

Interestingly, not all small membrane proteins require YidC for their biogenesis. For example, YajC and YhcB, both single-pass membrane proteins, do not show YidC-dependency for their membrane insertion . The requirement for YidC appears to be influenced by specific features of the substrate proteins, particularly the hydrophobicity of their transmembrane segments, as demonstrated by studies with SecG variants .

How does the structure of YidC contribute to its function?

The Tolumonas auensis YidC consists of 549 amino acids with multiple transmembrane segments and a periplasmic domain . The functional structure includes:

  • Multiple transmembrane regions that create a hydrophobic environment for substrate proteins

  • A large periplasmic domain between the first two transmembrane regions (recognized by peptide-specific antibodies)

  • Regions that provide an amphiphilic surface within the membrane to facilitate the transfer of polar protein segments

When reconstituted into liposomes for functional studies, YidC adopts an orientation with its periplasmic region facing inward, as confirmed by proteolysis experiments that generate a characteristic 42 kDa protease-resistant fragment . This fragment includes the large periplasmic domain between the first two transmembrane regions and is detectable with peptide-specific antibodies .

What is the functional relationship between YidC and its newly discovered interactor YibN?

Recent research has identified YibN as a bona fide interactor of YidC with significant implications for membrane protein biogenesis . This interaction was discovered through multiple complementary techniques:

  • BioID proximity labeling, which identified YibN as the protein with the highest spectral counts consistently across four replicates

  • SILAC-based affinity pulldown experiments showing that:

    • His-tagged YidC captured endogenous YibN (>20-fold enrichment)

    • His-tagged YibN captured endogenous YidC (>50-fold enrichment)

  • Native-gel electrophoresis demonstrating that purified YidC and YibN form a stable complex (labeled "YY")

Functionally, YibN enhances the production and membrane insertion of YidC substrates. Co-expression studies revealed that YibN significantly increases the synthesis of PC-Lep, Pf3-23Lep, and F0c . Additionally, in vitro translation/insertion assays using inverted membrane vesicles (INVs) demonstrated that YibN stimulates protein insertion . The YibN-YidC interaction appears to be mediated through YibN's N-terminal transmembrane segment, as deletion of this segment abolished complex formation .

How do hydrophobicity requirements differ between YidC-dependent and YidC-independent membrane insertion pathways?

The hydrophobicity of transmembrane segments plays a critical role in determining whether a protein requires YidC for membrane insertion. This relationship has been investigated using both natural substrates and engineered variants:

  • Pf3 coat protein with an extended hydrophobic region can insert independently of YidC into membranes both in vivo and in vitro, though its insertion is accelerated by YidC . This indicates that increased hydrophobicity can reduce YidC dependency.

  • Studies with SecG and its mutant variant carrying the I20E mutation in its first transmembrane segment showed differential response to YibN co-expression:

    • Wild-type SecG production was significantly increased by YibN

    • The I20E mutant (reduced hydrophobicity) was less affected by YibN

What are the mechanistic differences between YidC-only insertion and Sec-YidC cooperative insertion pathways?

Membrane protein insertion in bacteria occurs through two primary pathways involving YidC:

  • YidC-only pathway: Used by Sec-independent proteins like Pf3 coat protein and M13 procoat. In this pathway:

    • YidC directly catalyzes the insertion of substrate proteins into the membrane

    • Substrate proteins initially interact hydrophobically with the membrane in the absence of YidC, resulting in partial partitioning

    • YidC then facilitates the translocation of hydrophilic domains and promotes the folding of hydrophobic regions into a transmembrane configuration

    • This pathway does not require ATP or the proton motive force

  • Sec-YidC cooperative pathway: Used by more complex membrane proteins that require both systems. In this pathway:

    • The Sec translocase handles initial translocation steps

    • YidC works cooperatively with the Sec machinery to facilitate proper folding and integration of transmembrane segments

    • This pathway may require energy in the form of ATP hydrolysis or the proton motive force

The choice of pathway depends on the structural complexity of the substrate, with simpler proteins with fewer transmembrane segments typically using the YidC-only pathway, while more complex multi-spanning membrane proteins utilize the cooperative Sec-YidC pathway.

What are the optimal conditions for purifying functional recombinant Tolumonas auensis YidC?

For the purification of functional recombinant Tolumonas auensis YidC, researchers should consider the following protocol based on established methods:

  • Expression system: Use SuptoxR E. coli strains with co-expression of rraA, which achieve significantly higher biomass and dramatically increased yields for membrane proteins of both prokaryotic and eukaryotic origin .

  • Buffer composition: Purify in Tris-based buffer with 50% glycerol, optimized for YidC stability .

  • Storage conditions: Store at -20°C for short-term use, or -80°C for extended storage. Avoid repeated freeze-thaw cycles by maintaining working aliquots at 4°C for up to one week .

  • Detergent selection: For functional studies, n-dodecyl-β-D-maltoside (DDM) has been successfully used for YidC solubilization while maintaining its activity .

  • Quality control: Verify proper folding using blue-native PAGE, which can distinguish between monomeric YidC and complexes with interaction partners .

How can researchers effectively reconstitute YidC into proteoliposomes for functional assays?

Reconstitution of YidC into proteoliposomes for functional assays requires careful attention to several parameters:

  • Lipid composition: Use E. coli phospholipids to maintain a native-like environment. A mixture of phosphatidylethanolamine (PE) and phosphoglycerol (PG) is critical for proper YidC function .

  • Protein:lipid ratio: The optimal density is approximately 25 YidC molecules per liposome, corresponding to a protein:lipid ratio of 1:25,000 . Efficient membrane insertion is observed when more than 5 molecules of YidC are present in each liposome .

  • Reconstitution method:

    • Solubilize purified YidC in detergent (typically DDM)

    • Mix with lipids at the appropriate ratio

    • Remove detergent by dialysis or using adsorbent beads

    • Verify YidC orientation by protease protection assays (the periplasmic region should be inside the liposomes, generating a characteristic 42 kDa protease-resistant fragment)

  • Functionality assessment: Test the reconstituted proteoliposomes using purified Pf3 coat protein as a substrate. Efficient insertion (micrograms of protein within minutes) indicates properly reconstituted and functional YidC .

What experimental approaches can be used to assess YidC-substrate interactions in vitro and in vivo?

Multiple complementary techniques can be employed to investigate YidC-substrate interactions:

  • In vivo approaches:

    • BioID proximity labeling: Fuse BirA* to YidC C-terminus to biotinylate proximal proteins, followed by streptavidin pulldown and mass spectrometry analysis

    • SILAC-AP/MS: Use stable isotope labeling with amino acids in cell culture followed by affinity purification and mass spectrometry to quantitatively assess protein interactions

    • Co-expression studies: Express YidC with potential substrates and analyze their membrane integration efficiency by western blotting at different time points

  • In vitro approaches:

    • Reconstituted proteoliposome assays: Add purified substrate proteins to YidC-containing proteoliposomes and monitor insertion over time

    • Native-gel electrophoresis: Analyze complex formation between purified YidC and potential interaction partners or substrates

    • Inverted membrane vesicle (INV) assays: Use INVs containing YidC for in vitro translation/insertion assays to assess membrane integration efficiency

    • Chemical crosslinking: Capture transient interactions between YidC and substrate proteins during the insertion process

How can researchers differentiate between YidC-dependent and YidC-independent membrane insertion pathways?

To distinguish between YidC-dependent and YidC-independent membrane insertion pathways, researchers can implement several experimental strategies:

  • YidC depletion studies:

    • Use conditional YidC depletion strains to monitor the effect on substrate protein insertion

    • Truly YidC-dependent proteins will show significantly reduced membrane integration upon YidC depletion

    • YidC-independent proteins will maintain normal integration levels even in YidC-depleted conditions

  • Comparative kinetic analysis:

    • Measure the insertion rates of substrate proteins in the presence and absence of YidC

    • YidC-dependent proteins will show substantially slower or negligible insertion in the absence of YidC

    • YidC-independent proteins will insert spontaneously, though potentially at a slower rate without YidC

  • Hydrophobicity manipulation:

    • Introduce mutations that alter the hydrophobicity of transmembrane segments (e.g., I20E in SecG)

    • Monitor how these mutations affect YidC dependency

    • Compare the effect of YibN co-expression on wild-type versus mutant variants

  • Proteoliposome reconstitution:

    • Compare insertion efficiency into pure lipid liposomes versus YidC-containing proteoliposomes

    • YidC-dependent substrates will show minimal insertion into pure lipid vesicles but significant insertion into YidC proteoliposomes

    • YidC-independent substrates will insert into both types of vesicles with similar efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.