Recombinant Tolumonas auensis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Tola_2649; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Tolumonas auensis (strain DSM 9187 / TA4)
Target Names
nuoK
Target Protein Sequence
MNGIPFEHGLIVAAILFSLGLCGLLIRRNLLFILMSIEVLMNASAVAFVVAGSRHGQVDG QIMYILVISLAAAEASIGLALLMRMYRRHHTLNVDSVKEMHG
Uniprot No.

Target Background

Function
NDH-1 is an enzyme involved in electron transfer from NADH to quinones within the respiratory chain. In this species, the immediate electron acceptor is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation across the cytoplasmic membrane. For every two electrons transferred, four hydrogen ions are translocated, conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the fundamental characteristics of Tolumonas auensis as a bacterial species?

Tolumonas auensis is a gram-negative, rod-shaped bacterium isolated from anoxic freshwater lake sediments. Individual cells measure 0.9 to 1.2 by 2.5 to 3.2 microns and are characterized as nonmotile. The bacterium demonstrates optimal growth at 22°C and pH 7.2, with a DNA G+C content of 49 mol% .

This organism is notable for its ability to produce toluene from various precursors including phenylalanine, phenylpyruvate, phenyllactate, and phenylacetate, requiring both a carbon source and a toluene precursor for toluene production. T. auensis can grow under both oxic and anoxic conditions, producing acetate, ethanol, and formate as major fermentation products when grown on glucose . Taxonomically, it belongs to the gamma subclass of Proteobacteria, making it distantly related to other bacteria possessing NADH-quinone oxidoreductase complexes.

How does NADH-quinone oxidoreductase function in bacterial respiratory chains?

NADH-quinone oxidoreductase functions as a critical respiratory enzyme that catalyzes electron transfer from NADH to quinones while simultaneously translocating ions across the membrane to generate an electrochemical gradient. In many bacteria, this enzyme complex couples NADH oxidation to ion translocation (either H+ or Na+) across the membrane, building an electrochemical gradient that drives ATP synthesis and other cellular processes .

The complex typically contains multiple subunits and various cofactors including flavins and iron-sulfur clusters that facilitate electron transfer. For example, in Vibrio cholerae, the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) contains six subunits (NqrA-F) and several redox centers including flavin adenine dinucleotide (FAD), flavin mononucleotide (FMN), and iron-sulfur clusters . The arrangement of these cofactors creates an electron transfer pathway that spans from the cytoplasmic side to the periplasmic side and back to the cytoplasm.

What is the predicted role of the nuoK subunit in NADH-quinone oxidoreductase complexes?

Based on comparative analysis with similar respiratory complexes, the nuoK subunit likely plays a crucial role in the membrane-embedded portion of the NADH-quinone oxidoreductase complex. This subunit is predicted to be involved in forming the ion translocation channel and may contribute to the coupling of electron transfer to ion pumping across the membrane.

In analogous systems, membrane-embedded subunits like NqrB in V. cholerae's Na+-NQR complex form channels for ion translocation and contain redox cofactors that participate in electron transfer . Similarly, nuoK in T. auensis likely contributes to the structural integrity of the complex within the membrane environment and participates in the energy conservation mechanism by facilitating the conversion of redox energy to transmembrane ion gradient.

What expression systems are most effective for producing recombinant T. auensis nuoK protein?

For optimal expression of recombinant T. auensis nuoK, a combination of strategic approaches should be considered:

Recommended Expression Systems:

For methodological success, researchers should implement a dual-pronged approach combining codon optimization with fusion tags that enhance membrane protein solubility. Based on analogous work with NADH-quinone oxidoreductase components, incorporating a C-terminal histidine tag facilitates purification while a small solubility tag (such as SUMO or MBP) at the N-terminus can improve expression yields. Induction protocols should be optimized with lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) to minimize the formation of inclusion bodies.

What are the most effective purification strategies for recombinant nuoK protein?

Purification of recombinant nuoK requires specialized approaches due to its membrane-associated nature:

Methodological Workflow:

  • Membrane Fraction Isolation:

    • Cell disruption via high-pressure homogenization (20,000 psi)

    • Low-speed centrifugation to remove debris (10,000 × g, 20 min)

    • Ultracentrifugation to isolate membrane fraction (150,000 × g, 1 hour)

  • Solubilization Protocol:

    • Screen detergents systematically (n-dodecyl-β-D-maltoside (DDM), digitonin, LMNG)

    • Optimal solubilization at 2:1 detergent:protein ratio

    • Incubate with gentle rotation (4°C, 1-2 hours)

  • Chromatography Sequence:

    • Initial IMAC (immobilized metal affinity chromatography) using Ni-NTA

    • Size exclusion chromatography for oligomeric state determination

    • Optional ion exchange for higher purity

This methodological approach draws on principles established for other membrane-bound oxidoreductase components, where maintenance of the detergent micelle throughout purification is critical for structural integrity. Researchers should confirm protein identity through both Western blotting and mass spectrometry, with particular attention to detecting the presence of any cofactors that may co-purify with the protein.

How can researchers assess the functional activity of purified recombinant nuoK?

Due to nuoK being a single subunit of a multi-subunit complex, functional assessment requires specialized approaches:

Activity Assessment Methods:

  • Reconstitution Experiments:

    • Incorporation into liposomes or nanodiscs

    • Co-reconstitution with other NADH-quinone oxidoreductase subunits

    • Ion flux measurements using fluorescent probes (e.g., ACMA for proton translocation)

  • Binding Assays:

    • Interaction studies with quinone analogs using isothermal titration calorimetry

    • Co-purification experiments with other complex subunits

    • Crosslinking studies to identify interaction partners

  • Spectroscopic Analyses:

    • Circular dichroism to confirm secondary structure integrity

    • Fluorescence spectroscopy to monitor conformational changes

    • EPR spectroscopy if iron-sulfur clusters are present

When interpreting activity data, researchers should recognize that the isolated nuoK subunit may not display full enzymatic activity without the complete complex. Therefore, comparative analyses with the behavior of equivalent subunits from related bacterial species (such as NqrD/NqrE in V. cholerae) can provide valuable contextual information for understanding partial activities or interaction capabilities .

What structural characterization methods are most informative for T. auensis nuoK?

Advanced structural characterization of T. auensis nuoK requires a multi-technique approach:

Recommended Structural Analysis Techniques:

  • Cryo-Electron Microscopy:

    • Single-particle analysis for high-resolution structure determination

    • Sample preparation in detergent micelles or reconstituted into nanodiscs

    • Data collection at 300 kV with direct electron detectors

  • X-ray Crystallography:

    • Crystallization screening with specific membrane protein screens

    • Lipidic cubic phase crystallization attempts

    • Crystal optimization with antibody fragments or fusion partners

  • NMR Spectroscopy for Dynamics:

    • Selective isotope labeling (15N, 13C) of nuoK

    • Solution NMR for detergent-solubilized protein

    • Solid-state NMR for reconstituted samples

The structural characteristics of membrane proteins like nuoK can be compared to available structures of similar respiratory complex components. For example, the V. cholerae Na+-NQR complex structure determination at 3.5 Å resolution revealed the arrangement of cofactors and subunits, including the membrane-embedded components . Similar approaches could be applied to T. auensis nuoK, particularly in the context of the complete NADH-quinone oxidoreductase complex.

How can researchers investigate the iron-sulfur cluster assembly in nuoK and its role in electron transfer?

Iron-sulfur cluster assembly and function in nuoK represents a sophisticated research area:

Methodological Approach:

  • Iron-Sulfur Cluster Characterization:

    • UV-visible spectroscopy to identify characteristic absorption peaks

    • EPR spectroscopy to determine redox states and spin configurations

    • Mössbauer spectroscopy for iron oxidation state determination

  • Iron-Sulfur Cluster Assembly Analysis:

    • Co-expression with iron-sulfur cluster assembly machinery proteins

    • In vitro reconstitution under anaerobic conditions

    • Site-directed mutagenesis of predicted ligand residues

  • Electron Transfer Kinetics:

    • Stopped-flow spectroscopy to measure electron transfer rates

    • Potentiometric titrations to determine redox potentials

    • Pulse radiolysis for ultra-fast electron transfer measurements

Drawing parallels from the V. cholerae NQR complex, which contains an iron center in the membrane-embedded part and a 2Fe-2S cluster in the NqrF subunit , researchers should investigate whether nuoK directly coordinates an iron-sulfur cluster or interacts with other subunits containing these cofactors. The arrangement of redox centers is crucial for understanding the electron transfer pathway through the complex and ultimately the coupling mechanism to ion translocation.

What comparative genomic approaches can reveal the evolutionary context of T. auensis nuoK?

Comparative genomics offers valuable evolutionary insights:

Analytical Framework:

  • Phylogenetic Analysis:

    • Multiple sequence alignment of nuoK homologs across bacterial species

    • Construction of maximum likelihood phylogenetic trees

    • Ancestral sequence reconstruction to identify conserved features

  • Domain Architecture Analysis:

    • Identification of conserved domains using tools like InterPro and Pfam

    • Comparison with equivalent subunits in related complexes (e.g., Complex I, Na+-NQR)

    • Analysis of covariation patterns within sequence alignments

  • Genomic Context Examination:

    • Analysis of operon structure and gene neighborhood

    • Comparison with nqrABCDEF operon organization in V. cholerae

    • Identification of co-evolved components including potential assembly factors

Based on the organization of the nqr operon in V. cholerae, which includes the structural genes nqrABCDEF along with accessory genes like apbE (encoding a flavin attachment protein) and nqrM (involved in iron delivery) , researchers should investigate whether similar accessory genes are associated with the nuo operon in T. auensis. This genomic context can provide insights into the maturation pathway and assembly requirements for the functional complex.

What are common experimental challenges when working with recombinant nuoK and how can they be addressed?

Researchers face several challenges when working with recombinant nuoK:

Challenge-Solution Matrix:

ChallengeUnderlying CauseSolution Strategy
Low expression yieldsMembrane protein toxicity- Use specialized expression strains (C41/C43)
- Employ tightly regulated promoters
- Lower induction temperature (16°C)
Protein aggregationImproper folding or detergent mismatch- Screen multiple detergents systematically
- Add stabilizing ligands during purification
- Consider fusion partners that enhance solubility
Loss of cofactorsDisruption of native environment- Supplement growth media with precursors
- Co-express with assembly factors
- Include cofactors in purification buffers
Inactive proteinImproper reconstitution- Verify protein folding with circular dichroism
- Reconstitute with natural lipids from T. auensis
- Test different pH and salt conditions

When addressing challenges related to iron-sulfur cluster incorporation, researchers should consider co-expression with iron-sulfur cluster assembly systems or in vitro reconstitution under strictly anaerobic conditions. For optimal experimental design, draw from approaches used in the study of V. cholerae Na+-NQR, where specific genes (apbE and nqrM) were identified as essential for proper complex maturation and cofactor incorporation .

How should researchers interpret contradictory data regarding nuoK function or interactions?

When facing contradictory experimental results:

Methodological Resolution Framework:

  • Systematic Validation:

    • Employ multiple independent methods to address the same question

    • Verify protein integrity before each experimental series

    • Use both in vitro and in vivo approaches when possible

  • Context Consideration:

    • Evaluate the influence of experimental conditions on outcomes

    • Consider the effects of detergents versus membrane environments

    • Assess whether the isolated subunit behaves differently than in the complete complex

  • Comparative Analysis:

    • Compare results with data from homologous proteins in related species

    • Evaluate whether discrepancies follow phylogenetic patterns

    • Consider functional constraints that may explain apparent contradictions

When interpreting data about nuoK function, researchers should recognize that respiratory chain components often display context-dependent behaviors. For example, in V. cholerae, the NQR complex function is interwoven with iron homeostasis, and the expression of its components is differentially regulated by iron availability . Similar interconnections may exist for T. auensis nuoK, potentially explaining seemingly contradictory experimental outcomes under different conditions.

What quality control metrics should be applied to structural and functional studies of recombinant nuoK?

Rigorous quality control ensures reliable research outcomes:

Quality Control Framework:

  • Protein Sample Quality:

    • Purity assessment: >95% by SDS-PAGE and size exclusion chromatography

    • Identity confirmation: Mass spectrometry and Western blotting

    • Stability monitoring: Thermal shift assays and time-course activity measurements

  • Structural Data Validation:

    • Resolution and data completeness metrics for crystallography or cryo-EM

    • Ramachandran statistics and side chain geometry analysis

    • Independent validation using orthogonal structural techniques

  • Functional Assay Validation:

    • Positive and negative controls for each assay

    • Concentration-dependent response curves

    • Statistical analysis with appropriate replicates (minimum n=3)

Researchers should implement comprehensive controls when studying recombinant nuoK, including parallel analysis of known NADH-quinone oxidoreductase components from well-characterized systems like V. cholerae Na+-NQR. Additionally, verification that the recombinant protein contains the expected cofactors is essential, as their absence would significantly impact both structural and functional properties.

What is the relationship between iron metabolism and nuoK function in T. auensis?

The interconnection between iron metabolism and respiratory chain function observed in other bacteria suggests important relationships for nuoK:

Studies in V. cholerae have revealed that the expression of the nqr operon is induced by iron, and the lack of functional NQR has a strong impact on iron homeostasis . This relationship is bidirectional: iron availability affects NQR expression and function, while NQR activity influences iron uptake and utilization systems.

For T. auensis nuoK, researchers should examine:

  • Whether iron availability regulates nuoK expression

  • If the nuoK-containing complex requires specific iron delivery systems for assembly

  • Whether nuoK deletion affects expression of iron uptake systems

This investigation should include quantitative expression analysis of iron transport genes (like feoB) in wild-type and nuoK deletion strains under varying iron conditions, similar to the approach used in V. cholerae studies .

How can researchers leverage nuoK as a potential target for metabolic engineering applications?

Strategic modification of nuoK offers potential for metabolic engineering:

Application-Oriented Approaches:

  • Enhancing Respiratory Efficiency:

    • Site-directed mutagenesis to optimize coupling between electron transfer and ion translocation

    • Engineering variants with altered ion specificity (H+ vs Na+)

    • Creating chimeric proteins with subunits from other bacterial species

  • Metabolic Flux Manipulation:

    • Controlling nuoK expression to shift between respiratory and fermentative metabolism

    • Engineering strains with altered NADH/NAD+ ratios to influence toluene production

    • Modifying nuoK to alter the energetic cost of toluene biosynthesis

  • Biosensor Development:

    • Creating reporter systems based on nuoK expression regulation

    • Developing whole-cell biosensors for iron availability

    • Engineering nuoK variants sensitive to specific environmental conditions

When designing metabolic engineering strategies involving nuoK, researchers should consider the dual role of T. auensis as both a respiratory organism and a toluene producer . Modifications that enhance respiratory efficiency could potentially be leveraged to improve toluene production by increasing energy availability for biosynthetic pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.