Recombinant Tolumonas auensis Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Tolumonas auensis Protease HtpX

Protease HtpX from Tolumonas auensis is a specialized enzyme classified under EC number 3.4.24.-, indicating its identity as a metalloproteinase . This protein is encoded by the htpX gene (locus name: Tola_1101) in the Tolumonas auensis genome . As a recombinant protein, it is produced through heterologous expression systems, allowing for the generation of purified protein suitable for research and commercial applications. The protein's UniProt accession number C4LDD1 serves as its unique identifier in protein databases .

Origin and Classification

Tolumonas auensis is a gram-negative bacterium originally isolated from anaerobic sediments. Strain DSM 9187 / TA4 is the specific source organism for this protease . The bacterium belongs to the Aeromonadaceae family and is noted for its unique metabolic capabilities. HtpX proteases represent an important class of bacterial enzymes involved in cellular stress responses and protein quality control mechanisms.

Biochemical Classification

PropertyDetail
Protein TypeTransmembrane Metalloproteinase
Enzyme ClassificationEC 3.4.24.-
Gene NamehtpX
Locus NameTola_1101
UniProt IDC4LDD1
Alternative NamesHeat shock protein HtpX
OrganismTolumonas auensis (strain DSM 9187 / TA4)

This classification places HtpX within the broader family of zinc-dependent metalloproteases that play essential roles in protein processing and degradation within bacterial systems . The enzyme classification EC 3.4.24.- encompasses metalloendopeptidases, suggesting that HtpX functions by cleaving internal peptide bonds in target proteins.

Molecular Structure and Characteristics

Understanding the molecular structure of Recombinant Tolumonas auensis Protease HtpX provides crucial insights into its function and potential applications.

Domain Organization

Based on homology to similar proteins, HtpX likely contains an M48 peptidase domain, which is characteristic of zinc metalloproteases . This domain houses the catalytic machinery responsible for the protein's proteolytic activity. The presence of transmembrane domains suggests that the protein is anchored in the cell membrane, with the active site positioned to access and cleave specific substrate proteins.

Size and Physical Properties

PropertyValue
Molecular WeightApproximately 32-35 kDa (estimated from sequence)
Amino Acid Length291 residues
Protein TypeIntegral membrane protein
Domain StructureMultiple transmembrane domains with M48 peptidase domain
Cofactor RequirementsZinc (catalytic), potentially Calcium (structural)

The molecular characteristics of HtpX influence its stability, activity, and interactions with other cellular components. The protein's transmembrane nature presents specific challenges for recombinant expression and purification, requiring specialized protocols to maintain its native structure and function .

Recombinant Expression and Purification

The recombinant production of Tolumonas auensis Protease HtpX involves advanced molecular biology techniques to achieve high yields of functional protein.

Expression Systems

Recombinant Tolumonas auensis Protease HtpX can be expressed in multiple heterologous systems, each offering distinct advantages:

Expression SystemCharacteristicsApplications
E. coliHigh yield, cost-effective, rapid expressionBasic research, structural studies
YeastPost-translational modifications, higher eukaryotic-like processingFunctional studies
BaculovirusInsect cell expression, complex protein foldingStructural and functional analysis
Mammalian CellMost authentic post-translational modificationsFunctional studies requiring native-like protein

The choice of expression system depends on the specific requirements for protein authenticity, yield, and downstream applications . For basic biochemical characterization, E. coli-based expression systems often provide sufficient quantities of functional protein.

Purification and Quality Assessment

Recombinant HtpX is typically tagged to facilitate purification, with N-terminal His-tags being common . The purification process generally involves affinity chromatography followed by additional purification steps if necessary. Quality assessment typically includes SDS-PAGE analysis, which confirms a purity level of ≥85% for commercial preparations .

Storage recommendations for purified protein include maintaining at -20°C for short-term storage or -80°C for extended storage. Working aliquots can be stored at 4°C for up to one week . Repeated freeze-thaw cycles should be avoided to maintain protein integrity and activity.

Functional Properties and Enzymatic Activity

Understanding the functional properties of Recombinant Tolumonas auensis Protease HtpX provides insights into its potential applications in research and biotechnology.

Catalytic Mechanism

As a metalloproteinase (EC 3.4.24.-), HtpX likely employs a zinc-dependent catalytic mechanism for peptide bond hydrolysis . The active site typically contains a coordinated zinc ion that activates a water molecule for nucleophilic attack on the peptide bond. Based on research with similar proteases, the enzyme likely demonstrates specificity for certain amino acid sequences or structural motifs in substrate proteins.

Substrate Specificity

While specific substrate preferences for Tolumonas auensis Protease HtpX have not been extensively characterized in the provided search results, related research on similar proteases suggests potential roles in membrane protein quality control and degradation pathways. Research on comparable htpX proteases indicates they may target misfolded or damaged membrane proteins, contributing to protein homeostasis within bacterial cells .

Activity Modulation

Research on related htpX proteases suggests that calcium ions may influence the enzyme's activity by affecting the conformation of the active site pocket . A study on a similar htpX protease (DX-3-htpX) revealed that:

  • The enzyme exhibits characteristics of a neutral protease

  • It demonstrates heat resistance, maintaining activity at elevated temperatures

  • It contains an M48 peptidase domain common to zinc metalloproteases

  • Calcium binding may optimize the active site conformation for catalysis

These findings provide potential insights into the behavior of Tolumonas auensis Protease HtpX, though direct experimental confirmation would be necessary to establish these properties definitively for this specific enzyme .

Research Applications and Potential Uses

Recombinant Tolumonas auensis Protease HtpX has several potential applications in research and biotechnology, based on its properties and the functions of similar metalloproteases.

Protein Structure-Function Studies

The availability of recombinant HtpX enables detailed investigations into the structure-function relationships of this class of metalloproteases. Studies could explore:

  • The role of specific amino acid residues in catalysis

  • The structural basis for substrate recognition

  • The effects of mutations on enzyme activity and stability

  • Comparative analyses with other bacterial proteases

These studies contribute to our fundamental understanding of metalloprotease mechanisms and evolution.

Biotechnological Applications

Metalloproteases with well-defined specificity and stability often find applications in biotechnology. Potential applications for recombinant HtpX might include:

Application AreaPotential Use
Protein ProcessingSpecific cleavage of fusion proteins or tags
Structural BiologyControlled proteolysis for domain mapping
Antibody ResearchGeneration of specific antibody fragments
Diagnostic ToolsDevelopment of enzyme-based assays

The heat stability observed in similar proteases makes them particularly valuable for applications requiring resistance to challenging conditions .

Model Systems for Bacterial Stress Responses

As a heat shock protein, HtpX likely plays a role in bacterial stress responses. Recombinant versions of this protein enable research into:

  • Mechanisms of protein quality control in bacterial membranes

  • Stress response pathways in prokaryotic organisms

  • Bacterial adaptation to environmental challenges

  • Potential targets for antimicrobial development

Understanding these pathways has implications for both basic microbiology and applied fields such as antimicrobial development.

Experimental Methods for Characterization

Various experimental approaches can be employed to characterize the properties and functions of Recombinant Tolumonas auensis Protease HtpX.

Activity Assays

Enzymatic activity can be assessed using:

  • Synthetic peptide substrates with fluorogenic or chromogenic reporters

  • Zymography using protein-containing gels

  • Mass spectrometry-based approaches to identify cleavage sites

  • Real-time monitoring of proteolytic activity under varying conditions

These assays provide insights into substrate preferences, kinetic parameters, and the effects of various conditions on enzyme activity.

Cloning and Expression Strategies

Based on approaches used for similar proteins, effective strategies for htpX expression might include:

  • PCR amplification of the htpX gene using specific primers

  • Cloning into suitable expression vectors (e.g., pHT43)

  • Transformation into expression hosts such as E. coli BL21(DE3) or Bacillus subtilis

  • IPTG-induced expression followed by purification via affinity chromatography

Successful expression strategies must account for the transmembrane nature of the protein, potentially requiring detergents or other stabilizing agents to maintain proper folding and activity.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
htpX; Tola_1101; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Tolumonas auensis (strain DSM 9187 / TA4)
Target Names
htpX
Target Protein Sequence
MKRVLLFLATNLAVMLVLSIVLSVLSSFFGISTRGSGGLLLMAAVFGFGGSIISLLMSKW MAKRSYGVQVIEQPRSEIEYWLFNTVQRQAQQTGIGMPEVGIYDSPDMNAFATGANRNKA LVAVSSGLLYNMSRDEAEAVLAHEISHVANGDMVTLTLIQGVVNTFVIYISRVLAGIVSN FMRSDDEESSATGGIAYFAISMVFELIFGILASTIVMWFSRQREFRADAGSAKLVGKDKM IAALERLARGHDSQLDGSMMAFGINGKTAMTELFMSHPPLEKRIQALREMR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Tolumonas auensis Protease HtpX and what is its fundamental role in bacterial cells?

Tolumonas auensis Protease HtpX is a membrane-bound zinc metalloprotease that belongs to the M48 peptidase family . In bacterial cells, HtpX proteases generally participate in the proteolytic quality control of membrane proteins, working in conjunction with other proteases such as FtsH . The HtpX from Tolumonas auensis (strain DSM 9187 / TA4) is specifically encoded by the htpX gene (Ordered Locus Name: Tola_1101) . This protease plays a crucial role in maintaining cellular homeostasis by degrading misfolded or damaged membrane proteins, thereby preventing their accumulation which could be toxic to the cell .

HtpX is also known as Heat shock protein HtpX, suggesting its involvement in stress response mechanisms . The protein functions as an endoprotease, cleaving peptide bonds within protein substrates rather than removing amino acids from the termini . This activity is essential for the turnover of specific membrane proteins and contributes to bacterial adaptation to environmental stresses.

What are the key structural domains of HtpX and how do they contribute to function?

The HtpX protease contains several structural elements crucial for its function:

  • The Tolumonas auensis HtpX protein consists of 291 amino acid residues with a full-length sequence beginning with "MKRVLLF..." and ending with "...ALREMR" .

  • HtpX proteases typically contain a M48 peptidase domain, which is critical for their catalytic function . In the case of the related DX-3-htpX protease, this domain spans approximately amino acid positions 87-289 and contains metalloprotease (zincin) catalytic domains .

  • The protein's tertiary structure generally consists of multiple α-helices, β-strands, and coil regions that collectively form the active site and substrate-binding pocket .

The structure of HtpX includes transmembrane regions that anchor it within the cell membrane, positioning the catalytic domain appropriately to access and degrade membrane proteins . This membrane association is essential for its biological function in quality control.

How do metal ions affect the structure and function of HtpX proteases?

Metal ions play a crucial role in the structure and function of HtpX proteases:

  • Zinc (Zn²⁺) is essential for the catalytic activity of HtpX. The purified enzyme exhibits self-cleavage activity and can degrade substrate proteins only when supplemented with Zn²⁺ . This confirms HtpX as a zinc-dependent endoprotease .

  • Calcium (Ca²⁺) binding to HtpX can significantly alter the protein's three-dimensional structure and active sites . Studies on the related DX-3-htpX protease revealed that Ca²⁺ binding helps form the largest active pocket compared to other ions .

Based on analysis of DX-3-htpX (a related protease), the binding of different ions can change the 3D structure and active site characteristics as shown in the table below:

Protease FormActive Pocket Area (Ų)Active Pocket Volume (ų)
HtpX alone557.472837.241
HtpX-Ca²⁺918.1541378.221
HtpX-Cl⁻714.286867.364
HtpX-K⁺925.5441335.237

This data demonstrates that metal ion binding, particularly Ca²⁺, significantly enlarges the active pocket of HtpX proteases, potentially enhancing substrate accessibility and catalytic efficiency .

What expression systems are most effective for recombinant HtpX production?

Based on successful protocols with related HtpX proteins, several expression systems can be employed:

The B. subtilis system has demonstrated significant advantages, with the recombinant DX-3-htpX showing a 61.9-fold increase in fermentation level compared to native expression . This suggests that B. subtilis could be particularly effective for Tolumonas auensis HtpX expression as well.

How can researchers overcome HtpX self-degradation issues during purification?

HtpX proteases present a significant challenge during purification due to their tendency for self-degradation upon cell disruption or membrane solubilization . To overcome this issue, researchers can adopt the following methodology:

  • Purification under Denaturing Conditions: Extract and purify the protein under strong denaturing conditions to inhibit proteolytic activity . This approach has been successful with E. coli HtpX.

  • Zinc Chelation During Refolding: After purification, refold the denatured protein in the presence of a zinc chelator to prevent premature activation and self-cleavage . This strategy maintains the protein's integrity until experimental analysis is desired.

  • Controlled Zinc Reintroduction: When proteolytic activity is desired for experiments, supplement the refolded protein with Zn²⁺ to restore its catalytic function in a controlled manner .

  • Low-Temperature Handling: Perform all purification steps at reduced temperatures (typically 4°C) to minimize proteolytic activity .

  • Addition of Protease Inhibitors: Include appropriate metalloprotease inhibitors during the initial extraction steps, being careful to remove them before activity assays.

For Tolumonas auensis HtpX specifically, maintaining the protein in a Tris-based buffer with 50% glycerol after purification can help preserve stability during storage .

What are the optimal storage conditions for maintaining recombinant HtpX stability?

To maintain the stability and activity of recombinant Tolumonas auensis Protease HtpX, the following storage conditions are recommended:

  • Storage Buffer Composition: Store the purified protein in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein .

  • Temperature Requirements:

    • For short-term storage (up to one week), maintain working aliquots at 4°C

    • For medium-term storage, keep the protein at -20°C

    • For extended storage and maximum stability, store at -80°C

  • Aliquoting Strategy: Divide the purified protein into small working aliquots before freezing to avoid repeated freeze-thaw cycles, as these can significantly reduce enzymatic activity . Repeated freezing and thawing is not recommended for HtpX proteases .

  • Optimized Conditions Based on Related Proteases: Studies on related HtpX proteases indicate that maintaining a neutral pH environment (around pH 7) helps preserve enzyme activity during storage . The enzyme activity preservation rate was shown to be highest after storage in a pH 6 buffer for 8 hours in related HtpX proteins .

What activity assays are most reliable for characterizing HtpX proteolytic function?

Based on successful characterization of related HtpX proteases, several assays can be employed to reliably measure Tolumonas auensis HtpX activity:

  • Self-Cleavage Assay: Monitor the self-degradation of purified HtpX in the presence of zinc using SDS-PAGE analysis . This provides a direct demonstration of proteolytic activity and can be quantified by densitometric analysis of protein bands.

  • Casein Degradation Assay: Measure the degradation of the model substrate casein, which has been successfully used to characterize HtpX proteases . This can be quantified through colorimetric assays that detect released peptides or amino acids.

  • Membrane Protein Substrate Cleavage: Assess the ability of HtpX to cleave solubilized membrane proteins such as SecY . This can be monitored by:

    • In vitro assays using purified SecY and HtpX

    • In vivo assays by co-expressing both HtpX and the substrate protein and monitoring substrate degradation

  • Temperature and pH Profiling: Characterize the enzyme by determining optimal reaction conditions and stability parameters. For related HtpX proteases, the optimal reaction temperature was 45°C and optimal pH was 7 . Similar characterization should be performed for Tolumonas auensis HtpX.

  • Metal Ion Dependency: Assess activity in the presence and absence of various metal ions, particularly Zn²⁺ and Ca²⁺, to confirm the metal dependency of the enzyme and identify potential activity enhancers .

How do computational approaches contribute to understanding HtpX substrate specificity?

Computational approaches provide valuable insights into HtpX structure and function:

For the DX-3-htpX protease, computational analysis revealed that binding of Ca²⁺ resulted in the formation of the largest active pocket (918.154 Ų area, 1378.221 ų volume) compared to the enzyme alone or in the presence of other ions . Similar analysis of Tolumonas auensis HtpX could reveal unique structural features influencing its specificity.

How does Tolumonas auensis HtpX compare with HtpX proteases from other bacterial species?

Comparative analysis of HtpX proteases from different bacterial species reveals both conserved features and species-specific adaptations:

  • Conserved Functional Role: HtpX proteases from Tolumonas auensis, Escherichia coli, and other bacteria share the fundamental role of membrane protein quality control . In E. coli, HtpX works in conjunction with FtsH in the proteolytic quality control of membrane proteins , and this functional partnership likely extends to Tolumonas auensis HtpX as well.

  • Structural Similarities: All HtpX proteases contain the M48 peptidase domain and are zinc-dependent metalloproteases . The zinc-binding motif is crucial for catalytic activity across species.

  • Species-Specific Adaptations:

    • The Tolumonas auensis HtpX consists of 291 amino acids with specific sequence features

    • The E. coli HtpX has been characterized as membrane-bound with specific activity against SecY

    • The Priestia megaterium DX-3-htpX protease was characterized as a neutral, heat-resistant metalloprotease

  • Metal Ion Interactions: While all HtpX proteases are zinc-dependent , the binding of calcium ions to the DX-3-htpX protease has been shown to create the largest active pocket . This feature might vary across species, potentially reflecting adaptations to different cellular environments.

These comparisons suggest that while the core catalytic mechanism is conserved across bacterial species, there may be species-specific adaptations in substrate recognition, regulation, and environmental response.

What insights can functional genomics provide about htpX gene regulation across different species?

While the search results provide limited information specifically about htpX gene regulation, several insights can be drawn or hypothesized based on the available data:

  • Gene Conservation: The htpX gene is found across diverse bacterial species including Tolumonas auensis (Tola_1101) , Escherichia coli , and Priestia megaterium , suggesting a conserved and essential function in bacterial physiology.

  • Stress Response Regulation: The alternative name "Heat shock protein HtpX" suggests regulation as part of stress response pathways . This indicates that the gene is likely upregulated under stress conditions such as elevated temperatures, oxidative stress, or membrane protein misfolding.

  • Functional Interaction Networks: In E. coli, HtpX has been suggested to work in conjunction with FtsH , implying possible coordinated regulation of these proteases to maintain membrane protein homeostasis.

  • Expression Optimization: The successful recombinant expression of DX-3-htpX resulted in a 61.9-fold increase in fermentation level compared to native expression . This suggests that native htpX expression may be tightly regulated and relatively low under standard conditions, which is consistent with a role in quality control rather than bulk protein degradation.

How can recombinant HtpX be utilized as a tool for studying membrane protein degradation pathways?

Recombinant Tolumonas auensis HtpX and other bacterial HtpX proteases can serve as valuable tools for investigating membrane protein degradation pathways:

  • In Vitro Degradation Assays: Purified recombinant HtpX can be used to study the degradation of various membrane proteins in controlled conditions. This approach has been successful with E. coli HtpX, which was shown to cleave the membrane protein SecY . Similar experiments with Tolumonas auensis HtpX could reveal:

    • Substrate specificity patterns

    • Cleavage site preferences

    • Kinetic parameters of degradation

  • Reconstitution Systems: The purified enzyme can be incorporated into artificial membrane systems with potential substrate proteins to study the spatial aspects of membrane protein degradation.

  • Structure-Function Analysis: By creating site-directed mutants of key residues in the M48 peptidase domain or metal-binding sites, researchers can probe the mechanistic details of HtpX-mediated proteolysis .

  • Comparative Studies: Using recombinant HtpX from different bacterial species (including Tolumonas auensis) allows for comparative studies to identify conserved and species-specific aspects of membrane protein quality control.

  • Proteomic Applications: HtpX can be used as a probe to identify potential physiological substrates through targeted degradomics approaches, providing insights into the broader role of this protease in bacterial physiology.

What are the implications of HtpX research for understanding bacterial stress responses?

Research on HtpX proteases has significant implications for understanding bacterial stress response mechanisms:

  • Membrane Protein Homeostasis: HtpX plays a crucial role in maintaining membrane protein quality control, particularly under stress conditions that may increase protein misfolding . This function is essential for bacterial survival under various environmental stresses.

  • Heat Shock Response: The classification of HtpX as a heat shock protein indicates its involvement in temperature stress adaptation. Understanding how HtpX activity changes in response to temperature fluctuations provides insights into bacterial thermotolerance mechanisms.

  • Zinc Homeostasis: The zinc dependency of HtpX connects its function to zinc availability and homeostasis within bacterial cells. This relationship may represent an important aspect of bacterial adaptation to environments with varying metal ion availability.

  • Stress Resistance Mechanisms: The heat-resistant nature observed in related HtpX proteases suggests adaptation to function under stress conditions. For instance, the DX-3-htpX protease maintained over 90% enzyme activity after 8 hours at 50°C , indicating robust functionality under thermal stress.

  • Potential Antimicrobial Targets: Understanding the role of HtpX in bacterial stress responses could potentially identify new antimicrobial targets that disrupt proteostasis networks, particularly in pathogenic bacteria where stress response systems are crucial for virulence and persistence.

What emerging technologies could enhance the study of HtpX structure and function?

Several cutting-edge technologies hold promise for advancing our understanding of Tolumonas auensis HtpX structure and function:

  • Cryo-Electron Microscopy: This technique could provide high-resolution structural information about HtpX in its membrane environment, potentially revealing details about substrate binding and the conformational changes associated with catalysis.

  • Advanced Computational Methods: Beyond AlphaFold , emerging computational approaches combining machine learning with molecular dynamics simulations could provide deeper insights into HtpX dynamics, particularly the conformational changes induced by metal binding.

  • Single-Molecule Enzymology: Techniques that monitor individual enzyme molecules could reveal the mechanistic details of HtpX function, including potential processivity and the kinetics of substrate binding and product release.

  • In-Cell NMR Spectroscopy: This emerging methodology could potentially provide information about HtpX structure and dynamics in a native-like cellular environment.

  • Integrative Structural Biology: Combining multiple structural techniques (X-ray crystallography, NMR, mass spectrometry) could overcome the challenges of studying membrane-associated proteases like HtpX.

  • Improved Recombinant Expression Systems: Building on the success seen with B. subtilis WB800N for DX-3-htpX , further optimization of expression systems specifically for Tolumonas auensis HtpX could yield higher quantities of functional protein for structural and biochemical studies.

How might HtpX research contribute to biotechnological applications?

Research on HtpX proteases has potential biotechnological applications that extend beyond basic science:

  • Protein Engineering Tools: The ability of HtpX to cleave specific membrane proteins could be harnessed for targeted proteolysis in engineered biological systems.

  • Heat-Stable Enzyme Applications: The heat resistance observed in related HtpX proteases suggests potential applications in industrial processes requiring thermal stability.

  • Bioremediation: Given Tolumonas auensis' environmental niche, its HtpX protease might have unique properties adaptable to environmental biotechnology applications.

  • Structural Biology Tools: Engineered HtpX variants could serve as tools for selective membrane protein degradation in structural biology studies, potentially helping to stabilize challenging membrane proteins for crystallization.

  • Therapeutic Enzyme Development: Understanding the mechanism of membrane protein degradation by HtpX could inform the development of therapeutic proteases targeting specific membrane proteins in disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.