Recombinant Tolumonas auensis Protein CrcB homolog (crcB)

What is Tolumonas auensis and why is its CrcB homolog protein significant?

Tolumonas auensis is a gram-negative, rod-shaped bacterium isolated from anoxic sediments of freshwater lakes. It belongs to the gamma subclass of Proteobacteria and is notable for its ability to produce toluene from phenylalanine, phenylpyruvate, phenyllactate, and phenylacetate . The CrcB homolog protein in T. auensis is significant because it belongs to a family of membrane proteins implicated in fluoride ion transport and resistance mechanisms. CrcB homologs function primarily as fluoride efflux transporters that reduce intracellular fluoride concentration, thereby mitigating fluoride toxicity .

What is the molecular structure and characteristics of the T. auensis CrcB homolog?

The T. auensis CrcB homolog is a membrane protein with the following characteristics:

• Amino acid sequence: mLYSVLAISLGASAGAVSRWLLGLGFNTLFPTIPPGTLLANLLGGYLIGIAVTFFAANPN LPPEWRLLVITGFLGGLTTFSTFSAEVTTLLQQGRLLWAGGAIAVHVIGSLVMTLLGMAT MSLLQRS

• UniProt accession number: C4LAI3

• Gene name: crcB

• Ordered Locus Name: Tola_2564

• Expression region: 1-127

The protein contains hydrophobic domains consistent with its predicted role as a membrane channel protein involved in ion transport.

How can researchers effectively express recombinant T. auensis CrcB homolog for functional studies?

For optimal expression of recombinant T. auensis CrcB homolog, researchers can choose from several expression systems depending on experimental requirements:

• E. coli expression system:

  • Suitable for high-yield production and preliminary structural studies

  • Typically yields protein with >85% purity (SDS-PAGE)

  • Recommended for initial characterization studies

• Yeast expression system:

  • Provides eukaryotic post-translational modifications

  • Useful for studies requiring properly folded membrane proteins

  • Yields protein with >85% purity (SDS-PAGE)

• Mammalian cell expression system:

  • Optimal for complex functional studies requiring mammalian-type glycosylation

  • Provides better folding for complex membrane proteins

  • Recommended for interaction studies with mammalian proteins

• Baculovirus expression system:

  • Balances yield and post-translational modifications

  • Particularly useful for structural biology applications

For all expression systems, researchers should optimize conditions including induction temperature (typically 16-30°C), induction time (4-24 hours), and inducer concentration to balance protein yield with proper folding of this membrane protein.

What are the optimal storage and handling conditions for recombinant T. auensis CrcB homolog protein?

To maintain stability and functionality of recombinant T. auensis CrcB homolog:

• Storage buffer composition:

  • Tris-based buffer with 50% glycerol, optimized for protein stability

  • pH should be maintained between 7.0-8.0

• Storage temperature:

  • Store at -20°C for routine use

  • For extended storage, conserve at -20°C or -80°C

• Working conditions:

  • Store working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they compromise protein integrity

• Reconstitution protocol:

  • Briefly centrifuge vials prior to opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

How does the CrcB homolog in T. auensis compare functionally with CrcB proteins in other bacterial species?

Comparative analysis reveals both similarities and differences between T. auensis CrcB and homologs in other bacterial species:

What experimental approaches can be used to assess the fluoride transport activity of recombinant T. auensis CrcB homolog?

To evaluate fluoride transport activity of recombinant T. auensis CrcB homolog, researchers can employ several complementary approaches:

• Growth inhibition assays:

  • Culture bacterial cells expressing recombinant CrcB in media containing various NaF concentrations

  • Measure growth (OD600) over time to determine minimum inhibitory concentration (MIC)

  • Compare growth profiles between wild-type, CrcB-expressing, and CrcB-deficient strains

• Fluoride efflux measurements:

  • Load cells with fluoride and measure efflux rates using fluoride-selective electrodes

  • Compare efflux kinetics between control cells and those expressing recombinant CrcB

• Complementation studies:

  • Express T. auensis CrcB in fluoride-sensitive bacterial strains (e.g., crcB knockout mutants)

  • Assess whether expression restores fluoride resistance

  • Example: Studies with oral streptococci showed complementation between S. mutans EriC1 and S. sanguinis CrcB1/CrcB2

• Mutational analysis:

  • Generate site-directed mutants of conserved residues in CrcB

  • Evaluate effects on fluoride resistance to identify functionally critical residues

  • For example, the approach used with Pseudomonas putida demonstrated that ΔcrcB mutants showed altered growth profiles in the presence of NaF

How can researchers investigate the structure-function relationship of T. auensis CrcB homolog?

To elucidate structure-function relationships of T. auensis CrcB homolog:

• Protein crystallization and structural determination:

  • Express and purify recombinant CrcB at high concentrations (>5 mg/mL)

  • Utilize detergent screening to identify optimal conditions for membrane protein crystallization

  • Apply X-ray crystallography or cryo-electron microscopy for structural determination

• Computational modeling:

  • Employ homology modeling based on known structures of related proteins

  • Perform molecular dynamics simulations to predict ion permeation pathways

  • Identify potential fluoride binding sites through docking studies

• Site-directed mutagenesis:

  • Target highly conserved residues based on sequence alignments with characterized CrcB homologs

  • Evaluate effects of mutations on fluoride resistance and transport activity

  • Focus on residues predicted to line the ion conduction pathway

• Domain swapping experiments:

  • Create chimeric proteins with domains from different CrcB homologs

  • Assess function of chimeric proteins to identify domains critical for specificity

  • Compare with functional complementation studies between different bacterial CrcB homologs

What is the relationship between T. auensis CrcB homolog and stress response mechanisms?

Research on CrcB homologs in other bacteria suggests potential connections to broader stress response mechanisms:

What are the challenges in distinguishing the function of T. auensis CrcB homolog from other fluoride resistance mechanisms?

Distinguishing the specific contribution of CrcB from other fluoride resistance mechanisms presents several challenges:

How can researchers optimize recombinant T. auensis CrcB homolog for structural studies?

For structural biology applications of recombinant T. auensis CrcB homolog:

• Expression optimization:

  • Screen multiple expression systems (E. coli, yeast, insect cells)

  • Test various fusion tags (His, GST, MBP) to enhance solubility

  • Optimize induction conditions (temperature, inducer concentration, time)

  • Consider using specialized E. coli strains designed for membrane protein expression

• Purification strategy:

  • Use a two-step purification protocol combining affinity chromatography and size exclusion chromatography

  • Screen detergents systematically to identify optimal conditions for protein stability

  • Assess protein homogeneity by dynamic light scattering before crystallization trials

• Stability assessment:

  • Perform thermal shift assays to identify stabilizing buffer conditions

  • Use limited proteolysis to identify flexible regions that might hinder crystallization

  • Consider protein engineering to remove flexible termini or loops

• Alternative structural approaches:

  • If crystallization proves challenging, consider cryo-electron microscopy

  • For membrane topology determination, use biochemical approaches such as cysteine accessibility methods

  • Apply solid-state NMR for structural insights without crystallization

How might structural insights into T. auensis CrcB homolog inform the development of fluoride resistance modulators?

Understanding the structural basis of fluoride transport by CrcB homologs could lead to novel applications:

• Structure-based drug design:

  • Detailed structural information about the fluoride binding site and transport mechanism could enable design of specific inhibitors

  • Such inhibitors might enhance the effectiveness of fluoride as an antimicrobial agent against fluoride-resistant bacteria

• Engineered fluoride sensors:

  • Structure-function insights could guide the development of protein-based biosensors for fluoride detection

  • Modified CrcB proteins could be used in environmental monitoring applications

• Agricultural applications:

  • Soil bacteria expressing engineered CrcB variants might help remediate fluoride-contaminated soils

  • Enhanced fluoride resistance could improve bacterial survival in high-fluoride environments

• Comparative structural analysis:

  • Comparing CrcB structures across diverse bacterial species might reveal species-specific features

  • These differences could be exploited to develop species-selective antimicrobial strategies

What is the evolutionary significance of CrcB homologs across bacterial species?

The evolutionary aspects of CrcB homologs present intriguing research questions:

• Phylogenetic distribution:

  • CrcB homologs are widely distributed across bacterial phyla

  • In oral streptococci, different patterns of distribution are observed: some species have only EriC-type transporters, while others have both EriC and CrcB types

• Functional conservation vs. adaptation:

  • Despite sequence divergence, functional complementation studies suggest conserved mechanisms

  • Species-specific adaptations may reflect ecological niches with different fluoride exposure levels

• Co-evolution with riboswitch regulation:

  • Studies have shown that CrcB expression can be regulated by fluoride-responsive riboswitches

  • Investigating the co-evolution of CrcB proteins and their regulatory elements could provide insights into adaptation mechanisms

• Research approach:

  • Conduct comprehensive phylogenetic analysis of CrcB homologs across bacterial species

  • Correlate sequence variations with ecological niches and fluoride exposure

  • Perform functional characterization of CrcB homologs from diverse bacterial species to identify conserved and variable features