Recombinant Tomopeas ravus Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction to MT-CYB

MT-CYB encodes cytochrome b, a hydrophobic membrane protein integral to Complex III (ubiquinol–cytochrome c reductase). In Tomopeas ravus, this gene is expressed in recombinant systems (e.g., E. coli, yeast) to study mitochondrial function, evolutionary adaptations, or disease mechanisms .

Production Methods

  • Host Systems: Recombinant MT-CYB from Tomopeas ravus is typically produced in E. coli or yeast (Saccharomyces cerevisiae) using expression vectors .

  • Sequence and Structure: The protein spans 176 amino acids (partial sequence provided in product data) , with eight transmembrane helices characteristic of cytochrome b .

Research Applications

  • ELISA and Western Blot (WB): Used to detect cytochrome b in bat mitochondrial studies .

  • Functional Studies: Investigates electron transport chain dynamics or evolutionary adaptations in bats .

Product Availability

Product CodeFormatQuantityPriceSupplier
CSB-CF656386TAAXRecombinant protein50 µg$1,521.00CUSABIO
CSB-YP656386TAAX1Partial, yeast-expressedCustomOn inquiryCUSABIO

Note: Prices and formats vary by supplier and application requirements .

General MT-CYB Function

  • Electron Transport: Facilitates ubiquinol-to-cytochrome c electron transfer in Complex III .

  • Proton Pumping: Contributes to the proton gradient essential for ATP synthesis .

Technical Challenges

  • Low Heteroplasmy Detection: No published studies quantify heteroplasmy levels in Tomopeas ravus tissues.

  • Functional Validation: Limited data on how recombinant MT-CYB from T. ravus compares to native forms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Tomopeas ravus (Blunt-eared bat)
Target Names
Target Protein Sequence
MTNIRKSHPLLKIVNDALIDLPAPSNISSWWNFGSLLGICLTIQILTGLFLAMHYTSDTT TAFNSVTHICRDVNYGWLLRYLHANGASMFFICLYLHVGRGLYYGSYTYTETWNMGIILL FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYVGTDLVEWIWGGFSVDKATLT
Uniprot No.

Target Background

Function

Recombinant Tomopeas ravus Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), a crucial part of the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is essential for ATP synthesis.

Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What are the alternative names and classification details for MT-CYB?

Recombinant Tomopeas ravus Cytochrome b is known by several alternative names in scientific literature and databases:

  • Cytochrome b

  • Complex III subunit 3

  • Complex III subunit III

  • Cytochrome b-c1 complex subunit 3

  • Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

Gene nomenclature includes:

  • Official gene symbol: MT-CYB

  • Synonyms: COB, CYTB, MTCYB

The protein is classified as a transmembrane protein derived from Tomopeas ravus (Blunt-eared bat), with the UniProt accession number Q36118 .

What are the optimal storage conditions for maintaining recombinant MT-CYB activity?

For optimal preservation of Recombinant Tomopeas ravus Cytochrome b activity, the following storage conditions are recommended:

  • Short-term storage (up to one week): 4°C

  • Standard storage: -20°C

  • Extended storage: -20°C or -80°C

Repeated freeze-thaw cycles significantly compromise protein integrity and should be avoided. Instead, preparing working aliquots upon initial thawing is recommended to minimize repeated exposure to temperature fluctuations . For lyophilized preparations, reconstitution should be performed according to manufacturer guidelines, typically using sterile water to achieve concentrations of 0.1-1.0 mg/mL. Addition of glycerol (typically to a final concentration of 50%) helps maintain stability during storage .

The typical shelf life is approximately 6 months for liquid preparations at -20°C/-80°C, while lyophilized forms maintain stability for up to 12 months at -20°C/-80°C .

How should researchers validate the functional activity of recombinant MT-CYB?

Validation of recombinant MT-CYB functional activity requires multiple complementary approaches:

  • Biochemical activity assays: Measure electron transfer capacity using ubiquinol as substrate and cytochrome c as electron acceptor.

  • Spectroscopic analysis: Monitor characteristic absorption peaks at specific wavelengths (typically 562 nm for reduced cytochrome b).

  • Complex formation assessment: Evaluate the protein's ability to form the appropriate protein-protein interactions within Complex III using co-immunoprecipitation or blue native PAGE.

  • Structural integrity verification: Employ circular dichroism spectroscopy to confirm proper protein folding, particularly the alpha-helical content typical of transmembrane domains.

Research involving cytochrome b from related species has demonstrated that proper incorporation into membrane structures is essential for functional validation . When designing validation experiments, researchers should consider that as an integral membrane protein, MT-CYB may require specific lipid environments to maintain native conformation and activity.

What is the taxonomic significance of Tomopeas ravus cytochrome b sequence data?

Analyses of protein electrophoretic and mitochondrial cytochrome b sequence data have provided critical evidence for resolving the taxonomic placement of Tomopeas ravus within Chiroptera. These molecular analyses support the association of Tomopeas ravus with the chiropteran family Molossidae .

While protein electrophoretic data did not clearly define the precise placement within Molossidae, sequence analyses of cytochrome b have established Tomopeas as a basal and phylogenetically distant member of this family . This taxonomic insight has significant implications for understanding bat evolution and diversification patterns.

Prior to molecular analyses, the taxonomic position of this distinct bat was problematic, but cytochrome b sequence data has enabled researchers to propose a revised classification that accurately reflects evolutionary relationships. This provides an excellent example of how mitochondrial gene sequence data can resolve taxonomic uncertainties in challenging cases.

How does selection pressure influence cytochrome b evolution in different ecological niches?

Mitochondrial genes like cytochrome b encode proteins involved in oxidative phosphorylation, making them particularly susceptible to selection pressures related to metabolic adaptation. Variations in lifestyle and ecological niche can directly impact metabolic performance requirements, leading to adaptive evolution of these genes .

Research on cytochrome b evolution in rodents of varying lifestyles demonstrates this phenomenon. For example, in the Arvicolinae subfamily:

  • Subterranean species show increased ω values (ratio of nonsynonymous to synonymous substitution rates) compared to surface-dwelling species, indicating relaxed selection pressure.

  • Convergent amino acid substitutions have been identified among phylogenetically distant subterranean species, suggesting parallel adaptation to similar ecological constraints.

  • Eight specific protein domains exhibit increased nonsynonymous substitution ratios in subterranean species, highlighting functional regions particularly subject to adaptive evolution .

These findings provide a framework for investigating similar patterns in bat species like Tomopeas ravus, which may have undergone adaptive evolution in cytochrome b in response to its specific ecological niche and lifestyle.

What methodologies are recommended for comparative analysis of cytochrome b sequences across bat species?

For comprehensive comparative analysis of cytochrome b sequences across bat species, researchers should implement a multi-stage methodological approach:

  • Sequence acquisition and alignment:

    • Extract DNA from tissue samples using specialized protocols for mitochondrial DNA

    • Amplify cytochrome b using bat-specific primers

    • Sequence using both Sanger and next-generation sequencing methods for cross-validation

    • Perform multiple sequence alignment using MAFFT or MUSCLE algorithms with bat-specific gap penalties

  • Phylogenetic analysis:

    • Implement maximum likelihood, Bayesian inference, and maximum parsimony methods

    • Apply appropriate nucleotide substitution models (typically GTR+I+G for cytochrome b)

    • Conduct bootstrap analysis (>1000 replicates) and posterior probability assessment

    • Generate time-calibrated trees using fossil calibration points specific to Chiroptera evolution

  • Selection analysis:

    • Calculate dN/dS ratios to identify selection signatures

    • Apply branch-site models to detect lineage-specific selection

    • Implement tests for convergent evolution, particularly for species with similar ecological adaptations

    • Map amino acid changes onto protein structural models to evaluate functional significance

  • Structure-function correlation:

    • Map variable sites onto 3D protein models of cytochrome b

    • Identify variations in functional domains across bat lineages

    • Correlate sequence changes with ecological traits using phylogenetic comparative methods

This integrated approach has successfully resolved taxonomic relationships in complex bat lineages, as demonstrated in the case of Tomopeas ravus .

How can researchers effectively investigate the functional consequences of amino acid substitutions in MT-CYB?

Investigating functional consequences of amino acid substitutions in MT-CYB requires a multi-disciplinary approach combining computational prediction, structural analysis, and experimental validation:

  • Computational prediction:

    • Conduct conservation analysis across related species to identify evolutionary constrained residues

    • Apply SIFT, PolyPhen-2, and PROVEAN algorithms to predict the impact of substitutions

    • Use molecular dynamics simulations to model effects on protein stability and flexibility

    • Employ protein-specific energy functions to calculate ΔΔG values for mutations

  • Structural analysis:

    • Map substitutions onto available crystal structures of cytochrome b

    • Analyze proximity to functional sites (heme binding, ubiquinone binding, proton transfer pathways)

    • Evaluate changes in electrostatic potential and hydrophobicity

    • Assess impacts on transmembrane domain stability and orientation

  • Experimental validation:

    • Generate site-directed mutants in recombinant expression systems

    • Measure electron transfer kinetics for each variant

    • Evaluate proton pumping efficiency using reconstituted proteoliposomes

    • Assess protein stability through thermal shift assays and limited proteolysis

    • Quantify complex assembly efficiency through blue native PAGE and immunoprecipitation

Research on cytochrome b in rodents has demonstrated that even conservative substitutions can significantly impact protein complex structure when they occur at critical positions . The convergent amino acid substitutions identified in subterranean species indicate specific adaptive mechanisms that could be investigated in bat species using similar methodological frameworks.

What expression systems are optimal for producing functional recombinant MT-CYB?

Expression System Comparison Table:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, cost-effective, rapid growthLimited post-translational modifications, inclusion body formationUse specialized strains (C41/C43), lower induction temperature (16-20°C), fusion with solubility tags
Yeast (S. cerevisiae, P. pastoris)Eukaryotic processing, higher-order foldingLonger production time, complex media requirementsOptimize codon usage, use inducible promoters, supplement with heme precursors
Insect cellsNative-like membrane environment, post-translational modificationsHigher cost, technical complexityBac-to-Bac system, optimize MOI, harvest timing optimization
Mammalian cellsMost native-like processingHighest cost, lowest yieldTransient transfection optimization, stable cell line development

For E. coli-based expression, the addition of an N-terminal 10xHis-tag has proven effective for purification purposes . The use of specialized membrane protein expression strains and optimization of induction conditions are critical for obtaining properly folded protein.

For applications requiring post-translational modifications or precise folding of transmembrane segments, eukaryotic expression systems may provide advantages despite their higher cost and complexity.

What analytical methods can differentiate between proper and improper folding of recombinant MT-CYB?

As a transmembrane protein with complex structural requirements, ensuring proper folding of recombinant MT-CYB is critical for functional studies. Multiple complementary analytical approaches should be employed:

  • Spectroscopic methods:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content (expected high α-helical content)

    • Fluorescence spectroscopy to monitor tertiary structure through intrinsic tryptophan fluorescence

    • Absorption spectroscopy to verify heme incorporation (characteristic peaks at ~562 nm for reduced cytochrome b)

  • Hydrodynamic techniques:

    • Size-exclusion chromatography to assess aggregation state

    • Analytical ultracentrifugation to determine oligomeric status

    • Dynamic light scattering to evaluate size distribution and detect aggregates

  • Functional assays:

    • Electron transfer activity measurement using artificial electron donors/acceptors

    • Reconstitution into liposomes to assess membrane integration

    • Proton translocation assays using pH-sensitive fluorescent dyes

  • Structural validation:

    • Limited proteolysis to probe accessibility of cleavage sites (properly folded protein shows resistance to digestion in transmembrane regions)

    • Thermal shift assays to determine protein stability

    • Cysteine accessibility assays for properly formed disulfide bonds

Improperly folded MT-CYB typically shows characteristics such as increased aggregation, loss of secondary structure elements, altered spectroscopic properties, and significantly reduced or absent electron transfer activity. Comparative analysis with properly folded standards is essential for accurate assessment.

How can recombinant MT-CYB contribute to evolutionary studies of bat species?

Recombinant Tomopeas ravus Cytochrome b provides a valuable tool for comprehensive evolutionary studies of bat species through multiple research applications:

  • Phylogenetic marker development:

    • The full-length protein sequence (176 amino acids) serves as a reference for designing specific primers and probes for evolutionary studies .

    • Comparison with cytochrome b sequences from other bat species enables identification of conserved and variable regions for targeted phylogenetic analysis.

  • Structure-function evolutionary studies:

    • Recombinant protein allows experimental testing of functional hypotheses derived from sequence comparisons.

    • Site-directed mutagenesis can recreate ancestral states or evolutionary intermediates to trace adaptive changes.

    • The availability of the complete amino acid sequence facilitates mapping of substitutions onto structural models to evaluate their evolutionary significance.

  • Taxonomic resolution:

    • As demonstrated with Tomopeas ravus, cytochrome b sequence analysis has resolved taxonomic uncertainties, establishing this species as a basal member of Molossidae .

    • The protein serves as a benchmark for evaluating relationships among problematic bat taxa.

  • Adaptation studies:

    • Comparative analysis of selection signatures across bat lineages with different ecological niches.

    • Investigation of convergent evolution through identification of parallel substitutions in species with similar adaptations.

The taxonomic insights provided by cytochrome b analysis of Tomopeas ravus demonstrate the power of this approach for resolving phylogenetic relationships and understanding the evolutionary history of Chiroptera .

What methodological approaches are recommended for analyzing MT-CYB in relation to oxidative phosphorylation efficiency?

Analyzing Tomopeas ravus MT-CYB in relation to oxidative phosphorylation efficiency requires integrating biochemical, biophysical, and computational approaches:

  • Reconstitution studies:

    • Incorporate purified recombinant MT-CYB into proteoliposomes with other Complex III components

    • Measure electron transfer rates under varying substrate concentrations

    • Assess proton translocation efficiency using pH-sensitive fluorescent probes

    • Compare kinetic parameters with cytochrome b from species with different metabolic requirements

  • Respirometry analysis:

    • Utilize mitochondrial preparations supplemented with recombinant MT-CYB

    • Measure oxygen consumption rates under various substrate conditions

    • Determine respiratory control ratios as indicators of coupling efficiency

    • Quantify reactive oxygen species production as a measure of electron leakage

  • Structure-based computational modeling:

    • Generate atomic models of MT-CYB within the Complex III environment

    • Simulate electron transfer pathways and identify rate-limiting steps

    • Calculate energy barriers for key reaction steps

    • Predict the impact of specific amino acid variations on electron transfer efficiency

  • Comparative analysis framework:

    • Correlate sequence variations with measured biochemical parameters

    • Apply statistical modeling to identify associations between specific residues and functional outcomes

    • Implement phylogenetic comparative methods to account for shared evolutionary history

This integrated approach can reveal how specific adaptations in MT-CYB contribute to the metabolic demands associated with the ecological niche of Tomopeas ravus. Similar methodologies have successfully identified functional consequences of cytochrome b variations in other mammalian lineages adapting to specialized niches .

What are the most promising future directions for research involving Recombinant Tomopeas ravus Cytochrome b?

Future research involving Recombinant Tomopeas ravus Cytochrome b (MT-CYB) offers several promising directions:

These research directions would significantly advance our understanding of mitochondrial adaptations in bats and provide insights into the molecular mechanisms underlying the remarkable evolutionary success and ecological diversity of Chiroptera.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.