Recombinant Torpedo californica SITS-binding protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
SITS-binding protein; SP105
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-697
Protein Length
Full Length of Mature Protein
Species
Tetronarce californica (Pacific electric ray) (Torpedo californica)
Target Protein Sequence
ARRAKKMASNSGDSSPEPGIKEINETWKGAIACLGVALLFLMTIGVLYWQVVEKPDTNWV LRGQVSGLVWDKKSLSFSFKSLSQDKTFARIDARHLPVRGGALLNNHCWFNTTRFCHTWD GVANLQVTLDTPNQSVAECYRVEWTPLNCQVALQDCFSMVNTSWYGGGSMRLQYWPINNA NINSQPFVISDLQDTPTGYGSVLERYFLGSTGVAVRVHQEVPLHVGIESRKQLCLGIPPN AEMQPLRYTICVSDSLRSAHQQFGTVIPVVQPDQPDTSILRLPHWRSQRVADIALKLEHN LKTFTRKLKLHRLGEGIMDLGEQSTLLLSNEVDETLQSQNRYRGLRQLRLSITLSPFTSI DSHHFQTTLQEGRENLWLGLPSAANGSQGPLLMKWKGKFAVKLNISNEEAQDWFIEQVHS LQRRLEVDYVNLEVGVGSPYVGQAQHHSCRLCGDDYINQFALLAEKLGNGTTVSAATRTA HLPVFVRMVPRQSDWSHAGLKGLIPSILHYSLLGYSFFIPDVIGGSLTDGFLADEELFVR WMQIATFLPVMSFSTPPWVFGETWIVNVTRSCIHRHQTFVVPLLMKYAAEWTSLGHPVFR PLWWVSPSDPNTFTINDEFLIGDEVLVAPVTESGKVHRDIYLPGNSFQWKDMNTAQVFEG GTLLREYPVALTEVAVFIRQKSKYTPAIAEIQQATT
Uniprot No.

Target Background

Function

This glycoprotein is likely not a functional component of the chloride channel.

Protein Families
Glycosyl hydrolase 31 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Electroplax tissue, brain (200-fold less), and heart (500-fold less).

Q&A

What is Torpedo californica SITS-binding protein and what is its molecular identity?

Torpedo californica SITS-binding protein, also known as SP105, is a protein isolated from the Pacific electric ray (Torpedo californica). It has a UniProt identifier of P19965 and consists of a full-length mature protein spanning residues 2-697. The protein is believed to play a role in ion transport mechanisms, given that SITS (4-acetamido-4'-isothiocyanatostilbene-2,2'-disulfonic acid) is known to interact with anion transport proteins. To properly investigate its function, researchers should employ a combination of biochemical assays, structural analyses, and interaction studies to characterize its role in cellular processes .

When preparing experimental designs to study this protein, it's essential to recognize that Torpedo californica has been extensively used as a model organism in neuroscience research, particularly for studying acetylcholine receptors and related proteins. This evolutionary context provides valuable comparative insights when designing experiments involving the SITS-binding protein.

What is the amino acid sequence and structural features of the SITS-binding protein?

The full amino acid sequence of Torpedo californica SITS-binding protein spans 697 amino acids with the expression region from residues 2-697. The complete sequence is available in protein databases and commercial product descriptions, featuring specific domains and motifs critical for its function .

To properly analyze the structural features of this protein, researchers should employ a combination of computational prediction tools and experimental approaches. Computational methods such as hydropathy plots can identify potential transmembrane regions, while secondary structure prediction algorithms can suggest α-helical, β-sheet, and random coil distributions. For experimental structure determination, techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy would be appropriate depending on the specific research questions being addressed.

The structural analysis should focus particularly on identifying potential binding pockets for SITS and other ligands, as well as regions that might be involved in protein-protein interactions or post-translational modifications.

What are the optimal storage and handling conditions for maintaining protein stability?

Recombinant Torpedo californica SITS-binding protein requires specific storage conditions to maintain structural integrity and functional activity. The recommended storage buffer is a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein. For long-term storage, the protein should be kept at -20°C, with -80°C being preferred for extended storage periods .

Working aliquots can be maintained at 4°C for up to one week, but researchers should avoid repeated freeze-thaw cycles as these can lead to protein denaturation and activity loss . A methodological approach to preserving protein integrity includes dividing the stock solution into single-use aliquots before freezing, thus eliminating the need for multiple freeze-thaw cycles.

Additionally, researchers should consider adding protease inhibitor cocktails to storage buffers and maintaining strict temperature control during all handling procedures. Quality control testing before experiments is essential, using techniques such as circular dichroism to verify structural integrity or activity assays to confirm functional preservation.

How should researchers design binding studies for the SITS-binding protein?

Designing robust binding studies for Torpedo californica SITS-binding protein requires a multi-technique approach to generate comprehensive and reliable data. Researchers should implement the following methodological workflow:

  • Initial binding characterization should employ surface plasmon resonance (SPR) or bio-layer interferometry (BLI) to determine association and dissociation kinetics (kon and koff). These techniques provide real-time, label-free monitoring of interactions and can determine if binding follows simple or complex kinetic models.

  • Isothermal titration calorimetry (ITC) should be used as a complementary approach to determine thermodynamic parameters (ΔH, ΔS, ΔG) and binding stoichiometry. This method has the advantage of measuring binding in solution without requiring immobilization or labeling.

  • For structural insights into binding mechanisms, researchers should consider hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map regions of the protein that undergo conformational changes upon ligand binding. This approach provides peptide-level resolution of structural dynamics.

  • When comparing binding data across different techniques, researchers must account for method-specific biases. For example, surface immobilization in SPR may alter binding properties compared to solution-based measurements in ITC. Proper experimental design includes appropriate controls and validation across multiple methods.

This systematic approach allows researchers to develop comprehensive binding models that account for affinity, kinetics, thermodynamics, and structural changes, providing a more complete understanding of how ligands interact with the SITS-binding protein.

What approaches can be used to investigate Torpedo californica SITS-binding protein in relation to other nicotinic receptor proteins?

The nicotinic acetylcholine receptor system from Torpedo californica has been extensively studied as a model for understanding neurotransmitter receptor structure and function. When investigating the SITS-binding protein in relation to these receptors, researchers should consider the following methodological approaches:

  • Comparative structural analysis is essential, recognizing that the Torpedo receptor contains two distinct binding sites - one formed by an α and a γ subunit, and another by an α and a δ subunit, each with different ligand affinities . Researchers should examine whether the SITS-binding protein shares structural homology with components of these binding sites.

  • Binding site characterization should focus on specific residues known to be important in the Torpedo receptor, such as γY117/δT119 on loop E, which contributes to differential binding affinity for competitive antagonists . Corresponding regions in the SITS-binding protein should be identified through sequence alignment and structural modeling.

  • For investigating potential functional relationships, co-immunoprecipitation and proximity labeling techniques (BioID, APEX) can identify physical interactions between the SITS-binding protein and receptor components, while electrophysiological recordings can determine if the SITS-binding protein modulates receptor function.

  • Recombinant expression systems should be designed to allow controlled co-expression of the SITS-binding protein with various receptor subunits to study potential regulatory interactions. This could include the use of inducible expression systems to modulate relative expression levels.

By integrating these approaches, researchers can develop a comprehensive understanding of how the SITS-binding protein may interact with or regulate nicotinic receptor function in Torpedo californica and potentially in other systems.

How can researchers optimize purification protocols to enhance protein yield and quality?

Optimizing purification protocols for Recombinant Torpedo californica SITS-binding protein requires a systematic approach addressing multiple parameters throughout the workflow:

  • Expression system selection is critical for obtaining properly folded and functional protein. While E. coli systems offer high yield and simplicity , researchers should evaluate whether insect or mammalian expression systems might provide better post-translational modifications and folding for this complex protein.

  • Affinity tag selection significantly impacts purification efficiency. Although His-tags are commonly used , alternative tags such as GST or MBP may improve solubility and reduce aggregation. Strategic placement of the tag (N-terminal versus C-terminal) should be empirically determined based on protein structure predictions.

  • Buffer optimization should be conducted systematically through a factorial design approach, testing variables including:

    ParameterRange to TestConsiderations
    pH6.5-8.5Test in 0.5 unit increments
    NaCl concentration0-500 mMTest effect on solubility and binding
    Glycerol5-20%For initial buffers (not storage)
    Reducing agentsDTT, β-ME, TCEPCompare stability with each
    DetergentsNon-ionic, zwitterionicFor membrane-associated forms
  • Chromatography strategy development should implement a multi-step approach, typically beginning with affinity chromatography followed by polishing steps. Ion exchange chromatography parameters should be selected based on the theoretical isoelectric point of the protein, while size exclusion chromatography serves as a final step to ensure homogeneity.

At each purification stage, quality control assessments using SDS-PAGE, Western blotting, and activity assays ensure that only preparations meeting predetermined quality thresholds proceed to experimental use, thereby enhancing reproducibility across studies.

How can the SITS-binding protein be utilized in neuroscience research models?

The Torpedo californica SITS-binding protein offers several valuable applications in neuroscience research through methodological approaches that leverage its unique properties:

  • For neurotransmitter receptor studies, researchers can use the SITS-binding protein as a comparative model system. The Torpedo californica acetylcholine receptor system has been extensively characterized, with studies revealing two distinct binding sites formed by different subunit combinations (α-γ and α-δ), each with unique ligand affinities . By comparing the binding properties of the SITS-binding protein with these well-characterized receptor sites, researchers can gain insights into binding pocket architecture and evolution.

  • To study allosteric modulation mechanisms, researchers should develop fluorescently labeled SITS-binding protein variants to monitor conformational changes in real-time. Site-directed mutagenesis of conserved residues can identify key regions involved in allosteric communication networks. This approach can provide valuable insights into how structural changes propagate through similar proteins, including neurotransmitter receptors.

  • When investigating structure-function relationships, researchers should consider that Torpedo californica acetylcholinesterase is stabilized by divalent cations (Ca²⁺, Mg²⁺, and Mn²⁺), which protect the enzyme from thermal inactivation . Similar stabilization studies with the SITS-binding protein could reveal shared structural principles among Torpedo proteins and provide insights into evolutionary conservation of stabilization mechanisms.

  • For integrating the SITS-binding protein into broader neuroscience research, co-expression studies with other Torpedo proteins in heterologous systems can help map functional interactions and regulatory networks, potentially revealing new targets for neurological drug development.

These approaches provide a methodological framework for leveraging the SITS-binding protein to advance our understanding of neurotransmitter systems and molecular neuroscience mechanisms.

What computational methods are most appropriate for analyzing SITS-binding protein structure and function?

Computational analysis of Torpedo californica SITS-binding protein structure and function requires a multi-level approach that integrates various in silico methods:

Integration of these computational approaches, validated against experimental data when available, provides a robust framework for understanding and predicting SITS-binding protein structure-function relationships.

How should researchers design site-directed mutagenesis experiments for functional characterization?

Designing effective site-directed mutagenesis experiments for Torpedo californica SITS-binding protein requires a systematic approach to identify critical residues and predict functional impacts:

  • Target selection should begin with sequence alignment-based identification of conserved residues across related proteins. Particular attention should be paid to residues corresponding to those that contribute to differential binding affinities in the Torpedo receptor, such as γY117/δT119 on loop E, which affects antagonist binding . These evolutionary conserved positions are prime candidates for initial mutagenesis.

  • Structural impact prediction is essential before experimental validation. When designing stabilizing mutations, researchers should consider applying computational algorithms like PROSS, which has been successfully used to predict stability-enhancing mutations in Torpedo californica acetylcholinesterase . This approach can identify non-intuitive mutations that may improve protein stability.

  • The mutagenesis strategy should include both conservative and non-conservative substitutions at each target site:

    Substitution TypePurposeExample
    Alanine scanningRemoves side chain interactionsTyr → Ala
    ConservativePreserves chemical propertiesAsp → Glu
    Charge reversalTests electrostatic contributionsAsp → Lys
    Size alterationProbes steric requirementsPhe → Ala
    Hydrogen-bondingEvaluates H-bond importanceSer → Ala
  • For validating mutational effects, researchers should implement a multi-parameter characterization approach. This includes thermal stability assessment (differential scanning calorimetry), binding kinetics (surface plasmon resonance), and functional assays specific to the protein's activity. Studies on Torpedo californica acetylcholinesterase have shown that mutations can significantly alter thermal transition temperatures and activation energies , providing quantitative measures of stability changes.

By systematically designing and characterizing mutations, researchers can develop detailed structure-function maps of the SITS-binding protein, identifying critical residues for stability, binding, and potential allosteric mechanisms.

How should researchers interpret seemingly contradictory binding data from different experimental techniques?

When faced with contradictory binding data for Torpedo californica SITS-binding protein across different experimental techniques, researchers should implement a systematic reconciliation approach:

  • Method-specific artifacts must be carefully considered. Different techniques probe binding under different conditions - for example, surface plasmon resonance requires surface immobilization which may constrain protein conformational freedom, while solution-based methods like isothermal titration calorimetry allow full conformational sampling. Researchers should map how each method might bias measurements and design control experiments to quantify these effects.

  • Complex binding mechanisms often explain apparent contradictions. The binding sites of Torpedo nicotinic receptors show differential affinities for various ligands, with studies demonstrating that the α-γ binding site has higher affinity for certain competitive antagonists compared to the α-δ site . This demonstrates that multiple binding modes can exist within related protein structures. Researchers should fit data to multiple binding site models and evaluate whether the SITS-binding protein might exhibit similar complexity.

  • Conformational dynamics can reconcile disparate measurements. Studies on Torpedo californica proteins with reactivators have shown that the same compound can adopt different poses (productive versus non-productive) depending on experimental conditions, with temperature being a critical factor . This suggests that binding energetics are condition-dependent, and researchers should systematically vary temperature, pH, and ionic strength to map how these parameters affect binding equilibria.

  • Data integration requires appropriate statistical modeling. Rather than discarding "outlier" measurements, researchers should develop comprehensive binding models that incorporate all data with appropriate weighting based on measurement uncertainty. Bayesian approaches are particularly valuable for integrating diverse data types into unified binding models.

By applying this systematic approach, researchers can transform apparently contradictory binding data into deeper mechanistic insights about the complex binding properties of the SITS-binding protein.

What quality control measures should be implemented to ensure experimental reproducibility?

Ensuring experimental reproducibility with Torpedo californica SITS-binding protein requires implementation of rigorous quality control at multiple levels:

  • Protein preparation quality control is foundational. For recombinant production, the expression and purification protocol should include defined acceptance criteria for purity (typically >95% by SDS-PAGE), identity (confirmed by mass spectrometry), and functional activity (using standardized binding or activity assays). Commercial sources specify that the recombinant protein should be produced in E. coli and may include a His-tag for purification purposes .

  • Storage and handling protocols must be strictly standardized. The protein should be maintained in Tris-based buffer with 50% glycerol at -20°C for routine storage or -80°C for extended periods . Repeated freeze-thaw cycles must be avoided, and working aliquots should not be kept at 4°C for more than one week . These specifications are critical as protein stability directly impacts experimental outcomes.

  • Experimental design should incorporate appropriate controls and standards:

    Control TypePurposeImplementation
    Positive controlConfirms assay functionalityKnown binding partner or activity
    Negative controlEstablishes specificityHeat-denatured protein or non-binding mutant
    Internal standardNormalizes batch variationsReference compound with established response
    System suitabilityVerifies instrument performanceStandard calibration run before experiments
  • Data analysis workflows must be standardized and documented. This includes pre-established criteria for data inclusion/exclusion, standardized fitting procedures for binding data, and statistical methods appropriate for the experimental design. Whenever possible, automated analysis pipelines should be employed to minimize subjective interpretations.

Implementation of these quality control measures significantly enhances experimental reproducibility and facilitates meaningful comparison of results across different studies involving the SITS-binding protein.

What are the key considerations when planning structural studies of the SITS-binding protein?

Planning structural studies of Torpedo californica SITS-binding protein requires careful consideration of several methodological aspects to obtain reliable and interpretable results:

By addressing these considerations in structural study design, researchers can obtain more reliable and functionally relevant structural information about the SITS-binding protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.