Recombinant Trachelium caeruleum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Definition and Production

The recombinant atpI protein is a full-length polypeptide (1–247 amino acids) encoded by the atpI gene in T. caeruleum chloroplasts. It is expressed in E. coli with an N-terminal His-tag for purification via affinity chromatography . Key features include:

ParameterDetail
Gene IDatpI (Uniprot: A9QC93)
Protein Length247 amino acids
Expression SystemE. coli
Purification TagN-terminal His-tag
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C (avoid repeated freezing/thawing cycles)

Functional Role

ATP synthase subunit a (atpI) facilitates proton translocation across the thylakoid membrane, driving ATP synthesis during the light-dependent reactions of photosynthesis. In T. caeruleum, this subunit is part of a six-gene ATP synthase complex (atpA, atpB, atpE, atpF, atpH, atpI) encoded in chloroplasts .

Gene Rearrangements in Chloroplast Genomes

Trachelium caeruleum exhibits extensive chloroplast genome rearrangements, often mediated by repeats and tRNA genes. These structural changes include:

Genomic FeatureObservationReference
Inversion EventsA ~50-kb inversion involving rps4 and trnN regions
Repeat-Mediated RecombinationHigh variation in non-coding regions (e.g., trnH-GUG-psbA, accD-psaI)
Gene LossAbsence of accD, clpP, infA, and rpl23 in Campanulaceae lineages

These rearrangements suggest adaptive pressures in ATP synthase subunit evolution, particularly in atpI .

Positive Selection and Functional Evolution

Phylogenetic analyses reveal site-specific positive selection in ATP synthase subunits, including atpI. In Dipsacales (including T. caeruleum), three ATP subunit genes (atpA, atpB, atpI) show evidence of adaptive evolution, with dN/dS ratios >1 at specific codons .

Experimental Use in Studies

Recombinant atpI is used in:

  1. Structural Biology: Determining proton translocation mechanisms via X-ray crystallography/NMR.

  2. Evolutionary Studies: Comparing ATP synthase subunit divergence across Campanulaceae .

  3. ELISA Assays: Detecting atpI-specific antibodies in plant stress responses (e.g., ).

Challenges in Production

  • Low Solubility: Hydrophobic transmembrane domains may require detergents for proper folding.

  • Post-Translational Modifications: Chloroplast-specific modifications (e.g., phosphorylation) are absent in E. coli-derived proteins.

ATP Synthase Subunit atpI Across Taxa

SpeciesGenomic FeaturesKey Differences from T. caeruleum
Acorus americanusFull-length atpI (247aa), His-taggedDifferent expression host (E. coli)
Organellar ChromatophoreSimilar His-tagged construct (242aa)Shorter C-terminal region
Adoxaceae/CaprifoliaceaeVariable IR/SC boundaries; atpI under positive selectionHigher dN/dS ratios in atpI codons

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order, and we will fulfill it according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Trachelium caeruleum (Blue throatwort)
Target Names
atpI
Target Protein Sequence
MNILSCSTNILNGFYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSAALAVRK PQTIPTGIQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTIFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLAKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
Key component of the proton channel, directly involved in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a in Trachelium caeruleum?

ATP synthase subunit a (atpI) in Trachelium caeruleum is a chloroplastic protein component of the ATP synthase complex. The protein consists of 247 amino acids with a molecular structure characterized by transmembrane domains that anchor it within the thylakoid membrane. The complete amino acid sequence is: MNILSCSTNILNGFYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSAALAVRK PQTIPTGIQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTIFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLAKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH .

Functionally, subunit a forms part of the membrane-embedded F0 sector of ATP synthase, where it plays a crucial role in proton translocation across the membrane. It works in conjunction with the c-ring rotor to create a proton channel essential for the rotational mechanism that drives ATP synthesis. Unlike other subunits that may have independent functions, atpI's primary role is structural, contributing to the assembly and stability of the entire ATP synthase complex.

How does atpI differ from other ATP synthase subunits in plant chloroplasts?

The atpI subunit differs from other ATP synthase components in several key ways. Unlike the catalytic F1 subunits (α, β) that directly participate in ATP synthesis, atpI is part of the membrane-embedded F0 sector that facilitates proton movement. When compared to atpH (subunit c), which forms the c-ring rotor (81 amino acids in length), atpI is significantly larger (247 amino acids) and does not form oligomeric structures .

Research evidence suggests that atpI plays a chaperone-like role in the assembly of the ATP synthase complex, particularly in facilitating the incorporation of other subunits. This differentiates it from subunits with purely structural or catalytic functions. Studies on bacterial homologs have shown that deletion of atpI results in decreased ATP synthase activity and altered membrane association of the F1 sector, indicating its importance in maintaining proper complex assembly .

What expression systems are most effective for producing recombinant atpI?

For recombinant expression of Trachelium caeruleum atpI, E. coli-based systems have proven most effective due to their ability to handle membrane proteins. Based on comparative studies with related ATP synthase subunits, the following expression systems yield optimal results:

Expression SystemYieldAdvantagesLimitations
E. coli BL21(DE3)HighCost-effective, scalablePotential inclusion body formation
Cell-free systemsMediumAvoids toxicity issuesHigher cost, lower yield
Insect cellsMedium-HighBetter folding of membrane proteinsComplex setup, time-consuming

When using E. coli expression systems, optimization of induction conditions is critical. Induction at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) typically improves the yield of properly folded protein. Addition of membrane-mimicking detergents (such as n-dodecyl-β-D-maltoside) during purification helps maintain protein stability .

What experimental evidence supports the chaperone-like role of atpI in ATP synthase assembly?

The chaperone-like function of atpI in ATP synthase assembly has been substantiated through multiple experimental approaches. Studies of bacterial homologs have demonstrated that AtpI plays a necessary and sufficient role in the assembly of ATP synthase complexes. In particular, research has shown that AtpI facilitates the formation of the c-ring, which is essential for proper ATP synthase function .

In experiments with hybrid ATP synthase systems containing components from different bacterial species, ATP synthase complexes were found to contain a functional c-ring only when atpI was co-expressed. Without atpI, the c-ring failed to form properly, resulting in decreased enzyme activity. Furthermore, quantitative analyses showed that deletion of atpI resulted in:

  • 34% reduction in ATP synthase β subunit content associated with the membrane fraction

  • 2.7-fold increase in F1 sector in the cytoplasm

  • 50% reduction in ATP-driven proton-pumping activity

  • 30% reduction in ATPase activity relative to wild type

These findings collectively indicate that atpI facilitates proper assembly of the ATP synthase complex, particularly in ensuring that the F1 sector properly attaches to the membrane-embedded F0 components.

How do mutations in atpI affect ATP synthase assembly and function in vivo?

  • Reduced membrane association of the ATP synthase complex

  • Increased levels of unassembled F1 components in the cytoplasm

  • Decreased ATP synthesis and hydrolysis capabilities

  • Altered growth characteristics, particularly under stress conditions

In comparative growth experiments, ΔatpI mutants exhibited modest growth defects on malate media, manifesting primarily as extended lag phases rather than severely reduced growth rates. At pH 10.5, molar growth yields for ΔatpI mutants were approximately 79% of wild-type values, indicating that while the mutation impacts energy metabolism, compensatory mechanisms partially mitigate these effects in vivo .

What structural features of atpI contribute to its interaction with other ATP synthase subunits?

The structural features of atpI that facilitate interactions with other ATP synthase subunits include:

  • Transmembrane helices that position it correctly within the lipid bilayer

  • Specific amino acid sequences that mediate protein-protein interactions

  • Charged residues that form salt bridges with complementary regions on partner subunits

  • Hydrophobic patches that stabilize interactions within the membrane environment

Sequence analysis reveals that atpI contains multiple hydrophobic segments consistent with its role as a membrane protein. These transmembrane domains are crucial for positioning atpI within the thylakoid membrane and facilitating interactions with other membrane-embedded subunits, particularly the c-ring.

Experimental evidence supports a model where atpI interacts directly with monomeric subunit c, promoting its assembly into the oligomeric c-ring structure. This interaction appears to precede and enable the subsequent formation of the complete a-c complex that is essential for proton translocation .

What purification strategies yield the highest purity and stability for recombinant atpI?

Purification of recombinant atpI requires specialized approaches due to its hydrophobic nature as a membrane protein. Based on established protocols for similar ATP synthase subunits, the following multi-step purification strategy is recommended:

  • Initial Extraction: Solubilize membrane fractions containing atpI using a mild detergent buffer (1% n-dodecyl-β-D-maltoside or 1% digitonin) in Tris-based buffer (pH 8.0) with 150-300 mM NaCl.

  • Affinity Chromatography: For His-tagged recombinant atpI, use Ni-NTA affinity chromatography with imidazole gradient elution (20-300 mM) while maintaining detergent above critical micelle concentration.

  • Size Exclusion Chromatography: Further purify using gel filtration to separate oligomeric states and remove aggregates.

  • Ion Exchange Chromatography: Optional final purification step to achieve >95% purity.

Stability of purified atpI is maximized by storing in buffer containing 50% glycerol at -20°C for extended storage, with working aliquots maintained at 4°C for up to one week. Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein integrity .

Purification StepPurposeTypical Recovery (%)Purity Achieved (%)
Membrane extractionInitial isolation70-8030-40
Affinity chromatographyCapture step60-7070-80
Size exclusionPolishing step80-9085-95
Ion exchangeFinal polishing70-80>95

What analytical methods are most effective for characterizing recombinant atpI structure and interactions?

Several complementary analytical methods are essential for thorough characterization of recombinant atpI:

  • SDS-PAGE and Western Blotting: Confirm protein identity, assess purity, and detect potential degradation products. Silver staining provides higher sensitivity for detecting minor contaminants or breakdown products .

  • Circular Dichroism (CD) Spectroscopy: Evaluate secondary structure composition and proper folding of the recombinant protein, particularly important for transmembrane proteins like atpI.

  • Mass Spectrometry: LC-MS/MS analysis provides definitive identification and can detect post-translational modifications or proteolytic processing. Analysis of purified atpI samples has previously revealed unexpected breakdown products, highlighting the importance of this technique .

  • Crosslinking Studies: Chemical crosslinking followed by mass spectrometry analysis can identify interaction partners and binding interfaces within the ATP synthase complex.

  • Native PAGE and Blue Native PAGE: Assess oligomeric state and complex formation under non-denaturing conditions, particularly useful for monitoring atpI interactions with other ATP synthase subunits.

  • Reconstitution Assays: Incorporate purified atpI into liposomes to assess its functional integration into membranes, which can be validated using proteoliposome-based activity assays.

For studying interactions specifically, fluorescence resonance energy transfer (FRET) or surface plasmon resonance (SPR) techniques offer quantitative measures of binding kinetics between atpI and potential partner proteins.

How can researchers assess the functional integrity of recombinant atpI in experimental systems?

Assessing the functional integrity of recombinant atpI requires multiple complementary approaches focusing on both structural integrity and functional capacity:

  • ATP Synthesis Assays: The primary function of properly assembled ATP synthase can be measured by monitoring ATP production in reconstituted systems under conditions that generate a proton gradient. Luminescence-based ATP detection provides quantitative measurements with high sensitivity.

  • Proton Pumping Assays: ATP-driven proton pumping activity can be assessed using pH-sensitive fluorescent dyes in reconstituted liposomes. This approach has demonstrated >50% reduction in activity in ΔatpI samples, confirming atpI's importance for proper function .

  • ATPase Activity Measurements: Measuring ATP hydrolysis in the presence of detergents like octyl-glucoside, which activates hydrolytic activity independently of proton pumping, allows assessment of catalytic function. Typically performed using colorimetric assays that detect inorganic phosphate release.

  • Membrane Association Analysis: Subcellular fractionation followed by immunodetection of ATP synthase components (particularly the β subunit) in membrane versus cytosolic fractions provides insight into proper complex assembly. In functional systems, the majority of ATP synthase components should be membrane-associated .

  • Thermal Stability Assays: Differential scanning fluorimetry can assess the thermal stability of the recombinant protein, which correlates with proper folding and structural integrity.

When establishing a new experimental system, it is advisable to include positive controls (such as wild-type atpI) and negative controls (such as deletion mutants) to validate the assay's sensitivity and specificity.

What are the primary technical challenges in studying atpI function and structure?

Researchers studying atpI face several significant technical challenges:

  • Membrane Protein Expression and Purification: As a hydrophobic membrane protein, atpI presents inherent difficulties in expression, solubilization, and purification while maintaining native conformation. Current protocols still struggle with low yields and protein instability during purification processes.

  • Structural Analysis Limitations: Obtaining high-resolution structural data (via X-ray crystallography or cryo-EM) for membrane proteins like atpI remains challenging. This limits detailed understanding of interaction interfaces and functional domains.

  • Functional Reconstitution Complexity: Creating experimental systems that accurately replicate the native membrane environment and allow for functional assessment of atpI activity requires sophisticated liposome preparation and protein reconstitution techniques.

  • Assembly Pathway Elucidation: Tracking the temporal sequence of ATP synthase assembly and precisely defining atpI's role at each stage presents methodological challenges, particularly in distinguishing between direct and indirect effects of atpI activity.

  • Species-Specific Variation: Evidence suggests significant functional differences in atpI between species, complicating the generalization of findings from model organisms to Trachelium caeruleum or other plant species .

These challenges necessitate continued technological development, particularly in membrane protein structural biology and single-molecule analysis techniques.

How do environmental factors affect atpI function and ATP synthase assembly?

Environmental factors significantly influence atpI function and ATP synthase assembly through multiple mechanisms:

  • pH Effects: Studies in alkaliphilic bacteria have shown that pH drastically affects ATP synthase assembly and function. At elevated pH (10.5), ΔatpI mutants show more pronounced growth defects (79% of wild-type growth yield) compared to neutral pH conditions, suggesting pH-dependent roles for atpI .

  • Temperature Sensitivity: Temperature affects membrane fluidity and protein folding kinetics, with consequences for atpI-mediated assembly. Recombinant atpI stability is demonstrably temperature-sensitive, requiring storage at -20°C/-80°C for long-term preservation .

  • Ionic Strength and Composition: Electrostatic interactions critical for atpI binding to partner proteins are modulated by ionic conditions. Experimental evidence suggests that physiological concentrations of specific ions (particularly Mg²⁺) are required for proper assembly.

  • Light Conditions: As a chloroplastic protein in photosynthetic organisms, atpI function may be indirectly regulated by light-dependent signals that coordinate photosynthetic and ATP synthesis activities.

  • Lipid Environment: The composition of the membrane lipid environment significantly affects atpI orientation, stability, and interaction capabilities. Studies with reconstituted systems have shown that specific phospholipids are required for optimal ATP synthase assembly and function .

Understanding these environmental dependencies is crucial for experimental design, particularly when attempting to extrapolate in vitro findings to physiological conditions.

What comparative analyses between atpI and homologous proteins reveal about evolutionary conservation?

Comparative analyses of atpI across species provide valuable insights into evolutionary conservation and functional importance:

  • Sequence Conservation: Core functional regions of atpI show high sequence conservation across photosynthetic organisms, particularly in transmembrane domains and interaction interfaces. This conservation underscores their fundamental importance to ATP synthase function.

  • Functional Divergence: Despite sequence similarities, functional studies reveal species-specific adaptations. For example, atpI from alkaliphilic bacteria appears to have evolved specific features allowing ATP synthase to function efficiently under high pH conditions .

  • Assembly Role Conservation: The chaperone-like function of atpI in ATP synthase assembly appears to be conserved across diverse organisms, from bacteria to chloroplasts of higher plants, suggesting an ancient and essential role in bioenergetic systems.

  • Structural Variations: Comparative structural analyses show variations in non-critical regions, particularly loop regions connecting transmembrane domains. These variations may reflect adaptations to specific cellular environments or interactions with species-specific partner proteins.

  • Co-evolution Patterns: Statistical coupling analyses of atpI and its interaction partners (particularly c-subunits) reveal co-evolutionary patterns, with compensatory mutations maintaining critical functional interactions despite sequence divergence.

These evolutionary insights not only enhance our understanding of atpI function but also guide experimental approaches by identifying critical regions for mutagenesis studies and rational protein engineering.

What are the most promising directions for future atpI research?

Several promising research directions emerge from current understanding of atpI:

  • High-Resolution Structural Studies: Application of advanced cryo-EM techniques to determine the atomic structure of atpI within the assembled ATP synthase complex would provide invaluable insights into interaction interfaces and functional mechanisms.

  • Dynamic Assembly Analysis: Development of real-time imaging approaches to visualize the ATP synthase assembly process and precisely define the temporal sequence of atpI's chaperone-like activities.

  • Synthetic Biology Applications: Engineering of modified atpI variants with enhanced stability or altered specificity could facilitate development of more efficient bioenergetic systems for biotechnological applications.

  • Comparative Systems Analysis: Systematic comparison of atpI function across diverse photosynthetic organisms could reveal adaptations to specific environmental niches and inform our understanding of bioenergetic evolution.

  • Integration with Metabolic Networks: Investigation of how atpI-dependent ATP synthase assembly is coordinated with broader cellular metabolic networks would enhance our understanding of bioenergetic regulation in photosynthetic organisms.

These research directions promise to address critical knowledge gaps while also generating practical applications in areas ranging from agricultural improvement to bioenergy production.

How does understanding atpI function contribute to broader knowledge of bioenergetic systems?

Research on atpI makes several important contributions to our understanding of bioenergetic systems:

  • Assembly Mechanism Insights: Studies of atpI provide a model for understanding how complex, multi-subunit membrane protein complexes achieve proper assembly, with implications for other bioenergetic systems beyond ATP synthase.

  • Evolutionary Perspective: Comparative analysis of atpI across species illuminates the evolutionary history of ATP synthase and the conservation of essential bioenergetic mechanisms.

  • Regulatory Network Integration: Understanding how atpI function responds to environmental conditions provides insights into the regulatory networks that coordinate bioenergetic activities with broader cellular metabolism.

  • Structural Biology Advances: Technical approaches developed for studying atpI as a membrane protein contribute to broader methodological advances in membrane protein structural biology.

  • Biotechnological Applications: Knowledge of atpI's role in ATP synthase assembly informs potential biotechnological applications, including the development of more efficient bioenergetic systems for synthetic biology applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.