Recombinant Trachelium caeruleum NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Trachelium caeruleum (Blue throatwort)
Target Names
ndhC
Target Protein Sequence
MLLLYEYDIFWAFLIISSLIPILAFFLSGVLAPISKGPEKFSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWSMSFDVLGVSVFIEAFIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor. NDH couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Trachelium caeruleum NAD(P)H-quinone oxidoreductase subunit 3?

Trachelium caeruleum NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a chloroplast-encoded membrane protein consisting of 120 amino acids with the sequence: mLLLYEYDIFWAFLIISSLIPILAFFLSGVLAPISKGPEKFSSYESGIEPIGDAWLQFRIRYYMFALVFVVFDVETVFLYPWSMSFDVLGVSVFIEAFIFVLILIVGLVYAWRKGALEWS . This protein is part of the NDH complex located in the thylakoid membrane and contributes to one of the subunits that forms the membrane domain of the complex. The hydrophobic nature of the protein, evidenced by its amino acid composition, facilitates its integration into the thylakoid membrane where it participates in electron transport processes.

How does NAD(P)H-quinone oxidoreductase function within the chloroplast electron transport chain?

NAD(P)H-quinone oxidoreductase functions as a critical component in chloroplast electron transport by catalyzing the transfer of electrons from NAD(P)H to plastoquinone in the thylakoid membrane. This enzyme plays a dual role in energy and prenylquinone metabolism . The enzyme contributes to cyclic electron flow around Photosystem I, which is essential for balancing the ATP/NADPH ratio needed for photosynthesis .

Importantly, the NDH complex:

  • Reduces plastoquinone non-photochemically using stromal reductants

  • Participates in chlororespiration by maintaining electron flow in the dark

  • Contributes to cyclic electron flow, which is upregulated during environmental stress conditions

  • Helps prevent over-reduction of the stroma under stress conditions

Research has demonstrated that purified plastoglobules can function as quinone-containing substrates, accepting electrons from NADPH and recombinant NDC1 enzyme in vitro, indicating the importance of these structures in electron transport processes .

What is the genomic context of ndhC in the Trachelium caeruleum chloroplast genome?

The ndhC gene is encoded in the chloroplast genome of Trachelium caeruleum, which has a total size of 162,321 bp. The genome includes an inverted repeat (IR) of 27,273 bp, a large single-copy (LSC) region of 100,114 bp, and a small single-copy (SSC) region of 7,661 bp . A distinctive feature of the Trachelium chloroplast genome is the presence of 18 internally unrearranged blocks of genes that have been inverted or relocated within the genome relative to the ancestral gene order of angiosperm chloroplast genomes .

The Trachelium genome encodes 112 different genes, with 17 duplicated in the IR, and the ndhC gene is part of the ndh gene family that includes multiple subunits (ndhA-ndhK). Interestingly, ndhK in Trachelium caeruleum may be a pseudogene with internal stop codons, which could affect the function of the entire NDH complex . This genomic rearrangement and potential pseudogene status highlight the unique evolutionary aspects of the Trachelium chloroplast genome.

What are the optimal conditions for expressing recombinant Trachelium caeruleum NAD(P)H-quinone oxidoreductase subunit 3?

Based on research protocols for similar NDH subunits, optimal expression of recombinant Trachelium caeruleum NAD(P)H-quinone oxidoreductase subunit 3 can be achieved using the following methodology:

Expression System Parameters:

  • Host: E. coli (BL21 DE3 or similar strain)

  • Tag: N-terminal His-tag for purification purposes

  • Vector: pET-series expression vector with T7 promoter

  • Expression Temperature: 18-20°C (to reduce inclusion body formation)

  • Induction: 0.1-0.5 mM IPTG at OD600 of 0.6-0.8

  • Post-induction incubation: 16-18 hours

Buffer Composition for Protein Stability:

  • Tris/PBS-based buffer (pH 8.0) with 6% trehalose

  • For storage, addition of 50% glycerol and aliquoting for long-term storage at -20°C/-80°C is recommended

To overcome the hydrophobic nature of this membrane protein, addition of mild detergents (0.05-0.1% DDM or similar) during extraction and purification can improve solubility and functional yield.

How can researchers verify the functional activity of recombinant NAD(P)H-quinone oxidoreductase?

Verification of functional activity can be accomplished through several complementary approaches:

Spectrophotometric Enzyme Assays:

  • NADPH oxidation assay: Monitor the decrease in absorbance at 340 nm in the presence of electron acceptors like decyl-plastoquinone or other quinone analogs .

  • Cytochrome c reduction assay: Measure the increase in absorbance at 550 nm when using cytochrome c as a terminal electron acceptor.

Plastoquinone Reduction Assay:
Researchers can assess function using a system similar to that employed for NDC1, where purified plastoglobules function as quinone-containing substrates that accept electrons from NADPH and the recombinant enzyme . This can be monitored by HPLC analysis of the plastoquinone redox state before and after incubation.

In vivo Complementation:
Introduce the recombinant protein into ndh-deficient mutants to assess functional complementation through measurements of:

  • Chlorophyll fluorescence parameters (especially under light stress)

  • Post-illumination fluorescence rise (characteristic of NDH activity)

  • Cyclic electron flow rates around PSI

These approaches provide multiple lines of evidence for functional activity at both the biochemical and physiological levels.

What techniques are available for studying protein-protein interactions involving chloroplastic NAD(P)H-quinone oxidoreductase?

Several state-of-the-art techniques can be employed to study protein-protein interactions involving chloroplastic NAD(P)H-quinone oxidoreductase:

Co-immunoprecipitation (Co-IP):
Using specific antibodies against NAD(P)H-quinone oxidoreductase subunit 3 (similar to the antibodies described in result ), researchers can isolate the protein complex and identify interacting partners through mass spectrometry.

Split-Ubiquitin Yeast Two-Hybrid:
This membrane-specific variant of the yeast two-hybrid system is appropriate for studying interactions of membrane proteins like ndhC.

Bimolecular Fluorescence Complementation (BiFC):
This technique allows visualization of protein interactions in planta by expressing fusion proteins with complementary fragments of a fluorescent protein.

Cross-linking Mass Spectrometry:
Chemical cross-linking followed by mass spectrometry can identify proximal protein regions, particularly useful for membrane protein complexes.

Cryo-Electron Microscopy:
For structural studies of the entire NDH complex, cryo-EM approaches similar to those used for other respiratory complexes can be applied to understand the structural integration of ndhC.

A combined approach using these techniques provides a comprehensive view of the protein-protein interaction network of this important membrane protein.

How does NAD(P)H-quinone oxidoreductase contribute to plant stress tolerance mechanisms?

NAD(P)H-quinone oxidoreductase plays a crucial role in plant stress tolerance through multiple mechanisms:

Heat Stress Response:
Under heat stress conditions, the NDH-dependent cyclic electron flow (CEF) is activated as a compensatory mechanism when the FQR-dependent CEF declines . Research shows that following moderate heat stress, NDH activity can increase by approximately 130% in certain rice accessions with lower cyclic electron flow efficiency (lcef) .

Redox Balance Maintenance:
The enzyme prevents stroma over-reduction, especially under stress conditions, by providing an alternative electron sink . This is vital because:

  • It helps maintain the correct ratio of ATP/NADPH production

  • It prevents the formation of reactive oxygen species

  • It supports energy-dependent processes during stress

Thiol-Dependent Redox Regulation:
NAD(P)H-dependent systems are at the crossroads of chloroplast thiol-dependent redox regulatory and antioxidant systems . During stress, these systems help control the redox state of regulatory thiols in key enzymes, maintaining metabolic balance despite environmental challenges.

Table 1: NDH Activity Changes Under Heat Stress

ConditionNDH Activity in lcef rice (relative units)NDH Activity in hcef rice (relative units)Notes
Control (25°C)100 (baseline)~220 (higher baseline)hcef rice has naturally higher NDH activity
Heat Stress~230 (130% increase)~240 (10% increase)lcef rice shows more significant upregulation

This table illustrates how plants with different baseline capacities for cyclic electron flow respond differently to heat stress through NDH activity modulation .

What is the relationship between NAD(P)H-quinone oxidoreductase and hydrogen peroxide metabolism in chloroplasts?

NAD(P)H-quinone oxidoreductase has important connections to hydrogen peroxide metabolism in chloroplasts, forming part of an intricate redox regulation network:

  • Electron Flow Regulation: The NDH complex participates in cyclic electron flow, which helps prevent over-reduction of the electron transport chain and consequent ROS production, including hydrogen peroxide .

  • NADPH Homeostasis: By oxidizing NADPH, the enzyme helps maintain NADPH levels needed for antioxidant systems, particularly the ascorbate-glutathione cycle which detoxifies hydrogen peroxide :

    • NADPH is required by glutathione reductase (GR) to regenerate GSH

    • GSH is utilized by DHA reductase (DHAR) to regenerate ascorbate

    • Ascorbate is the substrate for ascorbate peroxidase (APX) which reduces H₂O₂ to water

  • Redox Signal Integration: The enzyme participates in the NTRC-2-Cys PRX redox system which affects hydrogen peroxide metabolism . Questions remain about "how the NTRC–2-Cys PRX redox system is regulated to avoid the futile loss of NADPH in vivo" and "how dynamic changes of NADPH and H₂O₂ affect chloroplast performance" .

This interrelationship positions NAD(P)H-quinone oxidoreductase as part of a sophisticated network balancing electron flow, redox homeostasis, and hydrogen peroxide metabolism in chloroplasts.

How does the function of NAD(P)H-quinone oxidoreductase differ between light and dark conditions?

The function of NAD(P)H-quinone oxidoreductase undergoes significant transitions between light and dark conditions:

Light Conditions:

  • Participates in cyclic electron flow around Photosystem I

  • Contributes to balancing the ATP/NADPH ratio

  • Helps prevent over-reduction of the electron transport chain

  • Works in concert with photosynthetic electron transport

Dark Conditions:

  • Involved in chlororespiration, maintaining electron flow in the absence of photosynthesis

  • Participates in enzyme oxidation processes in the dark through interaction with the thioredoxin system

  • May contribute to maintaining redox homeostasis overnight

Research has shown that 2-Cys peroxiredoxins (PRXs) are involved in the oxidation of chloroplast enzymes in the dark, and this process involves thioredoxin-like proteins (TRX L2 showing higher efficiency) . The NAD(P)H-quinone oxidoreductase system interacts with these redox systems, with the question remaining about "which additional mechanism(s), beside 2-Cys PRXs, participate in the process of chloroplast enzyme oxidation in the dark?"

The differential activity ensures that redox balance is maintained under changing light conditions, contributing to the plant's ability to adapt to the day-night cycle.

How do structural differences in NAD(P)H-quinone oxidoreductase across plant species impact function?

Analysis of NAD(P)H-quinone oxidoreductase across different plant species reveals evolutionary adaptations that impact function:

Sequence Variation:
Comparing the Trachelium caeruleum ndhC sequence with other species shows both conserved functional domains and species-specific adaptations. For example, comparing the amino acid sequences of Trachelium caeruleum (mLLLYEYDIFWAFLIISSLIPILAFF...) with Nasturtium officinale (mLLLYEYDIFWAFLIISSAIPVLAFF...) reveals subtle differences that may affect membrane integration or electron transfer efficiency.

Functional Implications of Genomic Context:
The chloroplast genome of Trachelium caeruleum has undergone extensive rearrangements, with 18 blocks of genes inverted or relocated relative to the ancestral angiosperm gene order . These rearrangements may affect the expression and regulation of the ndh gene cluster. Additionally, in Trachelium, ndhK may be a pseudogene with internal stop codons , which could necessitate functional adaptations in other NDH subunits, including ndhC.

Evolutionary Trade-offs:
Different plant lineages show various adaptations in their NDH complexes, reflecting environmental pressures:

  • Some algal lineages have lost ndh genes entirely

  • Plants adapted to high light environments may show enhanced NDH capacity

  • Species-specific post-translational modifications can fine-tune activity

These structural differences create natural variations in cyclic electron flow capacity, redox balance maintenance, and stress response characteristics across plant species.

What methodological challenges exist in differentiating the multiple roles of NAD(P)H-quinone oxidoreductase in plant cells?

Researchers face several methodological challenges when studying the diverse functions of NAD(P)H-quinone oxidoreductase:

Overlapping Electron Transport Pathways:
Multiple parallel pathways exist for cyclic electron flow, including both NDH-dependent and FQR-dependent routes . Distinguishing the specific contribution of NAD(P)H-quinone oxidoreductase requires:

  • Careful genetic approaches with specific mutants

  • Pharmacological inhibitors with appropriate controls

  • Time-resolved spectroscopic techniques

Compartmentalization Issues:
The enzyme functions within distinct chloroplast subcompartments, including thylakoid membranes and potentially plastoglobules . Researchers must:

  • Use appropriate fractionation techniques

  • Verify subcellular localization

  • Consider potential moonlighting functions

Temporal Dynamics:
The function shifts between light and dark conditions and responds dynamically to stress . This necessitates:

  • Time-course experiments

  • Consideration of circadian effects

  • Controlled application of stress treatments

Redox State Monitoring:
Accurately measuring the redox state of the plastoquinone pool and other electron carriers requires specialized techniques , including:

  • HPLC analysis of plastoquinone redox state

  • EPR spectroscopy for detecting semiquinone intermediates

  • Chlorophyll fluorescence techniques with specific signatures for NDH activity

By addressing these methodological challenges, researchers can better delineate the specific roles of NAD(P)H-quinone oxidoreductase in plant metabolism and stress responses.

How can crystal structure data inform the development of site-directed mutagenesis studies for NAD(P)H-quinone oxidoreductase?

Crystal structure data from related NAD(P)H-quinone oxidoreductases provides valuable insights for designing site-directed mutagenesis studies:

Key Structural Elements from Related Proteins:
The crystal structure of human NAD(P)H:quinone oxidoreductase (QR1) has revealed important catalytic features :

  • Tyrosine-128 and the loop spanning residues 232-236 close the binding site

  • These elements partially occupy the space left vacant by departing substrate or cofactor

  • In the human QR1-duroquinone structure, one ring carbon is significantly closer to the flavin N5, suggesting direct hydride transfer

Similarly, rat NADPH-cytochrome P450 oxidoreductase studies demonstrate:

  • Nicotinamide access to FAD is blocked by an aromatic residue (Trp-677) that stacks against the re-face of the isoalloxazine ring

  • Mutational studies (W677X, W677G) showed the nicotinamide moiety of NADP+ lies against the FAD isoalloxazine ring with a tilt of approximately 30 degrees

Proposed Mutagenesis Targets for Trachelium ndhC:
Based on these structures and sequence analysis of the Trachelium caeruleum protein, researchers should consider:

  • Membrane-anchoring residues: The hydrophobic amino acids in the transmembrane regions

  • Potential quinone-binding sites: Aromatic residues that might participate in electron transfer

  • Interface residues: Amino acids likely involved in subunit interactions within the NDH complex

  • Conserved motifs: Residues identical across species that likely serve essential functions

Table 2: Potential Mutagenesis Targets in Trachelium caeruleum ndhC

Residue TypeExample Target(s)Predicted EffectValidation Method
AromaticTryptophan, Tyrosine residuesDisruption of π-electron interactionsElectron transfer kinetics
ChargedLysine, Arginine residuesAltered electrostatic interactionsComplex assembly analysis
ConservedResidues identical in all plant ndhCLoss of essential functionComplementation assays
InterfaceResidues at predicted subunit boundariesDisrupted complex assemblyBN-PAGE analysis

These targeted mutations would provide mechanistic insights into the function and regulation of the Trachelium caeruleum NAD(P)H-quinone oxidoreductase.

What emerging technologies could advance our understanding of NDH complex assembly and function?

Several cutting-edge technologies hold promise for advancing our understanding of NDH complex assembly and function:

Cryo-Electron Tomography:
This technique allows visualization of macromolecular complexes in their native cellular environment, potentially revealing the structural integration of ndhC within the intact NDH complex in thylakoid membranes.

Single-Molecule FRET:
By labeling specific subunits with fluorophores, researchers can track conformational changes during electron transfer, providing insights into the dynamics of the complex during function.

CRISPR-Based Approaches in Chloroplasts:
Advances in plastid genome editing could allow more precise manipulation of ndhC and related genes, facilitating detailed structure-function studies.

Rapid-Mixing Time-Resolved Spectroscopy:
These techniques can capture transient intermediates in the electron transfer process, revealing the kinetic mechanism of NAD(P)H oxidation and quinone reduction.

In Situ Structural Studies:
New approaches combining cryo-fixation with focused ion beam milling and electron tomography could reveal the organization of NDH complexes within the native thylakoid membrane architecture.

Implementing these technologies would address key questions that remain unanswered, such as how NDH complexes interface with other photosynthetic components and how their activity is regulated in response to changing environmental conditions.

How might understanding NAD(P)H-quinone oxidoreductase function contribute to enhancing crop stress resilience?

Understanding NAD(P)H-quinone oxidoreductase function has significant implications for enhancing crop stress resilience:

Heat Tolerance Engineering:
Since NDH-dependent cyclic electron flow is activated under heat stress , engineering crops with optimized NDH complex activity could improve thermotolerance. This is particularly relevant given that NDH activity increases by approximately 130% in certain rice varieties following moderate heat stress .

Drought Resistance Strategies:
NDH-dependent cyclic electron flow increases under drought conditions , suggesting that enhanced NDH function could improve water-use efficiency under water-limited conditions by:

  • Maintaining photosynthetic ATP synthesis

  • Preventing photoinhibition

  • Optimizing stomatal regulation through redox signaling

Redox Balance Optimization:
The NDH complex helps prevent stroma over-reduction and contributes to redox homeostasis . Modulating NDH activity could:

Translational Research Pathway:

  • Identify natural variation in NDH complex composition and activity across crop varieties

  • Correlate NDH function with stress tolerance phenotypes

  • Develop molecular markers for NDH-related traits for breeding programs

  • Explore genetic engineering approaches to optimize NDH function

By applying these approaches, researchers could develop crop varieties with enhanced resilience to climate change-related stresses, contributing to sustainable agriculture in challenging environments.

What are the unresolved questions regarding the evolution of the NAD(P)H-quinone oxidoreductase complex in plant chloroplasts?

Several fundamental questions remain regarding the evolution of the NAD(P)H-quinone oxidoreductase complex:

Convergent Evolution vs. Conservation:
The chloroplast NDH complex shares similarities with both cyanobacterial NDH-1 and mitochondrial Complex I, raising questions about the evolutionary relationships between these systems. The unusual chloroplast genome structure of Trachelium caeruleum, with 18 internally unrearranged blocks of genes inverted or relocated relative to ancestral angiosperm gene order , provides an interesting model for studying this evolution.

Mechanism of Genomic Rearrangements:
The Trachelium chloroplast genome has a higher number of repeats and larger repeated sequences compared to eight other angiosperm chloroplast genomes, and these are concentrated near rearrangement endpoints . This observation leads to questions about the mechanism of these rearrangements:

  • Do repeats drive genomic rearrangements?

  • What selective pressures maintain these arrangements?

  • How do these rearrangements affect gene expression and regulation?

Pseudogene Dynamics:
In Trachelium, ndhK may be a pseudogene with internal stop codons, and other genes like clpP, ycf1, and ycf2 are highly diverged and may also be pseudogenes . This raises questions about:

  • The functional consequences of pseudogenization

  • The compensatory mechanisms that maintain NDH function

  • The evolutionary trajectory of these genes

Selective Pressures: What environmental or metabolic pressures have shaped the evolution of the NDH complex in different plant lineages? Some plant groups have lost NDH genes entirely, while others maintain them under apparent selection.

Addressing these questions will provide fundamental insights into chloroplast genome evolution and the adaptation of photosynthetic machinery to diverse environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.