Recombinant Trachelium caeruleum NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

What is the basic structure and function of NAD(P)H-quinone oxidoreductases in chloroplasts?

NAD(P)H-quinone oxidoreductases (NDH) in chloroplasts catalyze the two-electron transfer from NAD(P)H to quinones without any energy-transducing sites . Traditionally, these enzymes contain noncovalently bound FAD as a cofactor rather than FMN or iron-sulfur clusters, though exceptions exist with some variants containing covalently bound FMN or noncovalently bound FMN instead of FAD . In Trachelium caeruleum, these proteins are part of the chloroplast genome, which has undergone significant rearrangements associated with repeats and tRNA genes . The chloroplastic NAD(P)H-quinone oxidoreductase subunits work together in electron transport chains within the chloroplast.

How does the amino acid sequence of NAD(P)H-quinone oxidoreductase affect its function?

The amino acid sequence determines protein folding, cofactor binding sites, and catalytic activity. For instance, the NAD(P)H-quinone oxidoreductase subunit 4L from T. caeruleum consists of 100 amino acids with the sequence: MLEHVLVLSAYLFSVGLYGLITSRNMVRALICLELIFNAVNINFVTFSDFFDSRHLKGSI FAIFVIAIAAAEAAIGLAILSAIYRNRKSIHINQSNLLTK . This sequence contains hydrophobic regions consistent with membrane integration, which is crucial for the protein's function in electron transport. The sequence also determines substrate specificity—at alkaline pH, electrostatic repulsions between negatively charged phosphate groups in NADPH and membrane phospholipids can prevent NADPH oxidation .

What are the optimal expression systems for producing recombinant Trachelium caeruleum NAD(P)H-quinone oxidoreductase subunits?

Based on successful expression of the NAD(P)H-quinone oxidoreductase subunit 4L, E. coli serves as an effective heterologous expression system for these proteins . For optimal expression, the gene sequence should be codon-optimized for E. coli, and expression should include an N-terminal histidine tag to facilitate purification. The recombinant protein should be expressed as a full-length construct (e.g., 1-100 amino acids for subunit 4L) to maintain proper folding and function . After expression, purification using affinity chromatography yields protein with greater than 90% purity as determined by SDS-PAGE .

What are the recommended storage conditions for maintaining activity of recombinant NAD(P)H-quinone oxidoreductase proteins?

Recombinant NAD(P)H-quinone oxidoreductase proteins should be stored as lyophilized powder at -20°C or -80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles . For working stocks, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided to maintain protein integrity and activity .

What methodological approaches can be used to study electron transfer kinetics in NAD(P)H-quinone oxidoreductases?

To study electron transfer kinetics, researchers should employ:

• Spectrophotometric assays: Monitor the decrease in NAD(P)H absorbance at 340 nm or the reduction of artificial electron acceptors like dichlorophenolindophenol (DCPIP).

• Stopped-flow techniques: For rapid kinetic measurements of electron transfer between NAD(P)H and the enzyme's cofactors.

• Site-directed mutagenesis: To identify residues critical for cofactor binding and electron transfer.

• pH-dependent assays: To investigate the electrostatic effects on substrate binding, particularly relevant as alkaline pH can affect NADPH oxidation through electrostatic repulsion with membrane phospholipids .

• Inhibitor studies: Using rotenone (to which NDH-2 enzymes are insensitive) to distinguish these enzymes from Complex I activities .

How does the chloroplast genome structure of Trachelium caeruleum differ from other plant species, particularly regarding ndh genes?

The chloroplast genome of Trachelium caeruleum has undergone extensive rearrangements associated with repeats and tRNA genes . While comparative data specifically about T. caeruleum ndh genes is limited in the provided sources, insights can be gained from studies of related species. In Achyranthes species, for example, the NDH-B gene contains introns and is located in the IR region, with three exons (756 bp, 676 bp, and 777 bp) . The expansion and contraction of IR regions represent major evolutionary events that cause size variation and rearrangement in chloroplast genomes . These structural changes may affect the organization and expression of ndh genes, potentially leading to functional adaptations.

What insights do Simple Sequence Repeats (SSRs) provide about the evolution of NAD(P)H-quinone oxidoreductase genes in plant chloroplasts?

Simple Sequence Repeats (SSRs) are widely distributed in genomes, including chloroplast genomes, and can provide valuable information about genetic diversity and evolution. In Achyranthes species, 83-88 SSRs were identified in the chloroplast genome, with the majority being mononucleotide SSRs (76-82) . The high variability of SSRs in chloroplast genomes provides strong evidence for molecular breeding and identification of medicinal plants . For NAD(P)H-quinone oxidoreductase genes, SSR analysis can reveal evolutionary relationships and genetic diversity among different plant species, potentially highlighting selective pressures on these genes. Researchers studying T. caeruleum should examine SSR patterns in and around ndh genes to understand their evolutionary history.

How do variations in NAD(P)H-quinone oxidoreductase subunits across plant species reflect adaptation to different environmental conditions?

Variations in NAD(P)H-quinone oxidoreductase subunits across species may reflect adaptations to different light intensities, temperature ranges, or other environmental factors. The ecological presence of Trachelium caeruleum on ancient walls in Braga, Portugal suggests adaptation to specific environmental niches. At the molecular level, variations in NAD(P)H-quinone oxidoreductase subunits might affect electron transfer efficiency, substrate specificity, or regulatory mechanisms.

For researchers, a comparative analysis methodology should include:

• Sequence alignment of homologous subunits across species from different habitats

• Identification of conserved domains versus variable regions

• Correlation of amino acid substitutions with environmental parameters

• Analysis of selection pressure using dN/dS ratios

• Experimental validation of functional differences using recombinant proteins from different species

How can researchers differentiate between the functions of different NAD(P)H-quinone oxidoreductase subunits in chloroplasts?

To differentiate between functions of different subunits, researchers should employ:

• Gene knockout or silencing: Use CRISPR-Cas9 or RNAi to selectively inhibit expression of specific subunits.

• Complementation assays: Express individual recombinant subunits in mutant plants lacking specific ndh genes to determine if function is restored.

• Protein-protein interaction studies: Use techniques like co-immunoprecipitation, yeast two-hybrid, or bimolecular fluorescence complementation to identify which subunits interact directly.

• Structure-function analysis: Compare amino acid sequences across subunits, focusing on conserved domains that might indicate shared functions versus unique regions that suggest specialized roles.

• Spectroscopic techniques: Use specific spectroscopic signatures to monitor electron transfer through different components of the NAD(P)H dehydrogenase complex.

What is the role of cofactors in NAD(P)H-quinone oxidoreductase activity, and how can researchers experimentally determine cofactor binding?

NAD(P)H-quinone oxidoreductases typically contain noncovalently bound FAD as a cofactor, although some variants have been reported with covalently bound FMN or noncovalently bound FMN instead of FAD . Some NDH-2 enzymes also contain EF-hand motifs that bind calcium . These cofactors are essential for electron transfer from NAD(P)H to quinones.

To experimentally determine cofactor binding, researchers should:

• Spectroscopic analysis: UV-visible spectroscopy to detect characteristic absorption spectra of flavin cofactors (FAD or FMN).

• Fluorescence spectroscopy: Exploit the natural fluorescence of flavins to study cofactor binding and potential changes upon substrate addition.

• Circular dichroism: To examine changes in protein secondary structure upon cofactor binding.

• Isothermal titration calorimetry (ITC): To measure binding affinity and thermodynamic parameters of cofactor-protein interactions.

• X-ray crystallography or cryo-EM: To determine the precise binding site and orientation of cofactors within the protein structure.

How do introns in ndh genes affect gene expression and protein function in chloroplasts?

Introns play vital roles in gene expression regulation . In Achyranthes species, several genes related to electron transport contain introns, including ndhB which has one intron dividing the gene into three exons . Research suggests introns can:

• Regulate spatiotemporal gene expression patterns

• Enhance mRNA stability and export from the nucleus

• Potentially facilitate alternative splicing resulting in protein isoforms

• Influence translation efficiency through various mechanisms

For NAD(P)H-quinone oxidoreductase genes in chloroplasts, intron positioning and conservation across species may indicate functional importance. Researchers studying T. caeruleum should investigate whether splicing efficiency of ndh gene introns is affected by environmental conditions, potentially providing a mechanism for adjusting electron transport capacity in response to changing environments.

What are the most effective protein purification strategies for maintaining the activity of recombinant NAD(P)H-quinone oxidoreductase subunits?

For effective purification while maintaining activity:

• Affinity chromatography: Use His-tag affinity purification with careful optimization of imidazole concentrations to minimize non-specific binding while ensuring complete elution of the target protein .

• Buffer optimization: Use Tris/PBS-based buffers (pH 8.0) with 6% trehalose to maintain protein stability during storage .

• Gentle elution conditions: To preserve native conformation and activity.

• Avoid oxidizing conditions: Include reducing agents like DTT or β-mercaptoethanol during purification to protect potential redox-sensitive residues.

• Activity assays: Regularly test activity during purification steps to ensure the purification protocol preserves enzymatic function.

How can researchers accurately measure electron transfer rates in recombinant NAD(P)H-quinone oxidoreductase systems?

To accurately measure electron transfer rates:

What experimental design considerations should researchers account for when studying the effects of pH on NAD(P)H-quinone oxidoreductase activity?

When studying pH effects on NAD(P)H-quinone oxidoreductase activity, researchers should consider:

• Buffer system selection: Use overlapping buffer systems to cover a wide pH range (e.g., MES for pH 5.5-6.5, MOPS for pH 6.5-7.5, Tris for pH 7.5-9.0) while maintaining consistent ionic strength.

• Substrate specificity changes: At alkaline pH, the oxidation of NADPH might be prevented by electrostatic repulsion between the negative charges of the phosphate group and membrane phospholipids . Test both NADH and NADPH as substrates across pH ranges.

• Protein stability: Monitor protein stability at extreme pH values to distinguish between direct pH effects on catalysis versus indirect effects through protein denaturation.

• Membrane effects: If studying membrane-associated forms, consider how pH affects membrane properties and protein-membrane interactions.

• Physiological relevance: Relate experimental pH values to the physiological pH range of chloroplasts, which can vary between stroma and thylakoid lumen, and under different light conditions.