Recombinant Trachelium caeruleum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence

The full-length sequence (1-508aa) includes conserved transmembrane helices and chlorophyll-binding motifs. Key residues include:

  • Chlorophyll-binding domains: Six transmembrane helices forming a scaffold for chlorophyll a and other pigments .

  • Conserved regions: Homology with CP43 (psbC) and PSI subunits (PsaA/PsaB), reflecting evolutionary relationships .

Core Antenna and Reaction Center Stability

psbB (CP47) forms part of the PSII core complex, functioning as:

  1. Chlorophyll-binding scaffold: Binds 16 chlorophyll a and 2 chlorophyll a-like molecules, facilitating light energy transfer to the reaction center .

  2. Structural anchor: Interacts with D1/D2 proteins and CP43 (psbC) to stabilize the reaction center .

Regulation of Chlorophyll Biosynthesis

  • Psb28 dependency: Deletion of Psb28 (a thylakoid protein) disrupts CP47 synthesis and chlorophyll cyclization, leading to:

    • Accumulation of magnesium protoporphyrin IX methylester .

    • Reduced synthesis of PSI subunits (PsaA/PsaB) .

  • FPB1/PAM68 interaction: Mutations in FPB1 impair pre-CP47 complex formation, slowing CP47 synthesis rates .

Expression and Refolding

StepDetails
CloningpsbB gene amplified from T. caeruleum genomic DNA; inserted into E. coli expression vectors
InductionIPTG-induced expression at 16–25°C
PurificationNi-NTA affinity chromatography (His-tag binding)
ReconstitutionLyophilized powder dissolved in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol

Quality Control

  • SDS-PAGE: Single band at ~47 kDa confirms purity (>90%) .

  • Buffer Optimization: Tris/PBS-based buffer with trehalose prevents aggregation and enhances solubility .

Comparative Analysis of Recombinant psbB Across Species

SpeciesUniProt IDKey DifferencesSource
Trachelium caeruleumA9QC94Unique chloroplast genome rearrangements
Spinacia oleraceaP04160Conserved transmembrane domains; spinach model system
Amborella trichopodaQ70XY1Basal angiosperm; divergent N-terminal sequence
Lepidium virginicumA4QLD2Brassicaceae-specific residues in C-terminal region

Experimental Insights

  • Chlorophyll Deficiency: Psb28 mutants show elevated protoporphyrin IX release, indicating defective chlorophyll cyclization .

  • PSII Assembly: FPB1 mutants accumulate CP43-less PSII complexes, highlighting psbB’s role in antenna assembly .

ELISA and Antibody-Based Detection

  • ELISA kits: Recombinant psbB serves as a standard for quantifying CP47 in plant extracts .

  • Global antibodies: Rabbit polyclonal antibodies (e.g., AS04 038) detect psbB in higher plants, algae, and cyanobacteria .

Chloroplast Genome Studies

  • Genomic rearrangements: T. caeruleum’s psbB is embedded in a rearranged chloroplast genome, offering insights into evolutionary pressures .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Trachelium caeruleum (Blue throatwort)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTIVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGIINSWGGWGITGGTITYPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFTDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQY VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSTGLAKNQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGAGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYNDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
CP47 (Photosystem II chlorophyll apoprotein, psbB) is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions of PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient. This gradient is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of CP47 (psbB) in Photosystem II?

CP47, encoded by the psbB gene, is one of the essential components of the core complex of Photosystem II (PSII). It functions primarily as a chlorophyll-binding protein that helps catalyze the primary light-induced photochemical processes of PSII . The protein contains a six-transmembrane helical unit that binds chlorophyll molecules, playing a crucial role in light harvesting and energy transfer within the photosynthetic apparatus . Unlike peripheral light-harvesting components, CP47 is integral to the core reaction center, making it essential for photosynthetic function.

How does the Trachelium caeruleum chloroplast genome differ from other plant species?

Trachelium caeruleum possesses one of the most highly rearranged chloroplast genomes among land plants. Its chloroplast genome is 162,321 bp in total, with an inverted repeat (IR) of 27,273 bp, a large single-copy (LSC) region of 100,114 bp, and a small single-copy (SSC) region of 7,661 bp . The genome exhibits numerous structural rearrangements including inversions, gene duplications, gene reductions, and intron loss . One of the distinctive features is the high concentration of repeats and tRNA genes at or near inversion endpoints, making it significantly different from most angiosperm chloroplast genomes, which are typically highly conserved in gene order and content .

What methodological approaches are used to express recombinant CP47 from Trachelium caeruleum?

Recombinant expression of CP47 from Trachelium caeruleum typically involves these steps:

  • Gene isolation and vector design:

    • PCR amplification of the psbB gene from Trachelium caeruleum chloroplast DNA

    • Designing expression vectors with appropriate promoters for chloroplast proteins

  • Expression systems:

    • Prokaryotic systems (E. coli) for basic protein studies

    • Eukaryotic systems (yeast, insect cells) for more complex folding requirements

    • Plant-based expression systems for authentic post-translational modifications

  • Purification protocols:

    • Membrane protein isolation techniques using detergents

    • Affinity chromatography with His-tag or other fusion partners

    • Size exclusion chromatography for final purification

The complex membrane protein nature of CP47 often necessitates special consideration for proper folding and chlorophyll binding to maintain functionality.

How should researchers design experiments to account for the highly rearranged genome of Trachelium caeruleum?

When designing experiments with Trachelium caeruleum psbB, researchers should implement these strategies:

  • Primer design challenges: Due to the extensive rearrangements and repeats in the Trachelium chloroplast genome, researchers must carefully design PCR primers after thorough sequence analysis to avoid amplifying unintended regions . Primers should be tested against the complete chloroplast genome sequence to ensure specificity.

  • Genome walking approaches: For regions with unclear boundaries or complex arrangements, genome walking techniques may be necessary to verify gene boundaries and flanking sequences.

  • Confirmation of gene copy and arrangement:

    • Southern blot analysis to confirm gene copy number

    • Long-range PCR to verify gene arrangement

    • Next-generation sequencing to validate complex regions

  • Control selection: When comparing with other species, select appropriate controls that account for the unique genomic architecture of Trachelium caeruleum.

The presence of numerous repeats (Trachelium has the highest number and largest repeats among angiosperms, along with Pelargonium) requires extra verification steps to ensure experimental accuracy .

What are the optimal conditions for analyzing CP47 protein-chlorophyll interactions in vitro?

Optimal conditions for analyzing CP47-chlorophyll interactions include:

ParameterRecommended ConditionJustification
pH6.5-7.5Maintains native protein conformation and chlorophyll binding
Temperature4-25°CHigher temperatures may destabilize chlorophyll binding
Buffer25-50 mM phosphate or Tris with 0.05-0.1% mild detergentMaintains membrane protein solubility while preserving interactions
Salt100-150 mM NaClProvides ionic strength without disrupting protein-pigment interactions
Light exposureMinimal, amber tubesPrevents photooxidation of chlorophyll molecules
Reducing agents1-5 mM DTT or β-mercaptoethanolMaintains cysteine residues in reduced state

Analysis techniques should include absorption spectroscopy (350-750 nm range), circular dichroism, fluorescence spectroscopy, and potentially native mass spectrometry to characterize binding stoichiometry and affinity .

What controls should be included when studying the effects of mutations in recombinant CP47?

When studying mutations in recombinant CP47, the following controls are essential:

  • Wild-type protein control: Expression and analysis of non-mutated CP47 under identical conditions provides the baseline for comparison.

  • Conserved mutation controls: Include mutations at both conserved and non-conserved residues to distinguish between specific and general structural effects.

  • Cross-species validation: Compare effects with homologous mutations in CP47 from species with conventional chloroplast genomes (like Arabidopsis thaliana) to distinguish species-specific effects .

  • Negative controls:

    • Empty vector controls

    • Unrelated membrane protein controls to account for non-specific membrane effects

    • Heat-denatured protein samples

  • Functional assays validation: Include oxygen evolution measurements, electron transfer rates, and chlorophyll binding capacity measurements to comprehensively assess mutation impacts.

The chosen mutations should be based on sequence alignment across multiple species to target residues of predicted functional significance.

How do the structural rearrangements in Trachelium caeruleum's chloroplast genome affect CP47 expression and function?

The extensive rearrangements in Trachelium's chloroplast genome potentially affect CP47 expression and function through several mechanisms:

  • Regulatory context alterations: The inversions and rearrangements may place psbB in a different regulatory context compared to other plants, potentially affecting transcription rates and regulation . Analysis of promoter regions and expression levels shows that genes repositioned by inversions often have altered expression patterns.

  • Co-transcription impacts: In chloroplasts, genes are often co-transcribed in operons. The rearrangements in Trachelium may alter the operon structure containing psbB, affecting its co-expression with functionally related genes .

  • RNA processing effects: The location of repeats near gene boundaries can affect RNA processing and maturation, potentially leading to altered mRNA stability or translation efficiency.

  • Evolutionary adaptation: The CP47 protein may have adapted to compensate for these genomic changes, potentially exhibiting subtle structural or functional differences compared to homologs from plants with conserved genome organization .

Studies of transcript levels, protein accumulation, and functional assays compared across species with different chloroplast genome organizations would help elucidate these effects.

What insights can Trachelium caeruleum CP47 provide about the evolution of Photosystem II core proteins?

Trachelium caeruleum CP47 provides valuable evolutionary insights:

  • Structural conservation despite genomic rearrangement: Despite extensive chloroplast genome rearrangements, the CP47 protein remains functionally conserved, demonstrating the essential nature of its structure for photosynthesis .

  • Evolutionary relationships: CP47 is structurally related to CP43 (encoded by psbC) and to the N-terminal domains of PsaA and PsaB proteins of Photosystem I, suggesting ancient evolutionary relationships between these light-harvesting systems .

  • Adaptation mechanisms: Comparing CP47 sequences between Trachelium and species with conserved genome organization reveals which amino acid positions can tolerate substitutions and which remain invariant, providing insights into structure-function relationships.

  • Genomic context evolution: The preservation of psbB function despite its altered genomic context in Trachelium suggests mechanisms for maintaining essential gene function during dramatic genomic reorganization events .

Phylogenetic analyses incorporating CP47 from multiple species, including those with rearranged genomes like Trachelium, can reveal patterns of co-evolution between genome structure and protein function.

How does the binding affinity of chlorophyll molecules to Trachelium caeruleum CP47 compare with other plant species?

Comparative analysis of chlorophyll binding to CP47 across species reveals:

SpeciesChlorophyll Binding SitesBinding Affinity (Kd) RangeSpecial Features
Trachelium caeruleum16-17 predicted sites10⁻⁷-10⁻⁸ M (estimated)Potentially altered binding pocket organization due to evolutionary adaptations
Arabidopsis thaliana16 confirmed sites10⁻⁷-10⁻⁸ MWell-characterized model system
Spinacia oleracea (spinach)16 confirmed sites10⁻⁷-10⁻⁸ MTraditional experimental model
Chlamydomonas reinhardtii16 confirmed sites10⁻⁷-10⁻⁹ MGreen algal model with high conservation

Methodological approaches to study these differences include:

  • Recombinant expression with controlled chlorophyll incorporation

  • Spectroscopic analysis of binding (absorption, fluorescence, and CD spectroscopy)

  • Comparative protein modeling to identify structural differences in binding pockets

  • Isothermal titration calorimetry to directly measure binding energetics

Differences in binding affinity, if present, may reflect adaptations to specific light environments or compensatory changes related to the genome rearrangements in Trachelium caeruleum .

What are the challenges in isolating intact CP47 protein from Trachelium caeruleum, and how can they be overcome?

Isolating intact CP47 from Trachelium caeruleum presents several challenges:

  • Membrane protein solubilization:

    • Challenge: CP47 is an integral membrane protein with multiple transmembrane helices.

    • Solution: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin at optimized concentrations (typically 0.5-1%) to maintain native structure.

  • Maintaining chlorophyll association:

    • Challenge: Chlorophyll molecules easily dissociate during extraction.

    • Solution: Perform all steps under dim green light, at 4°C, and include stabilizing agents like glycerol (10-20%) in buffers.

  • Protein degradation:

    • Challenge: Proteolytic degradation during extraction.

    • Solution: Include a cocktail of protease inhibitors (PMSF, leupeptin, pepstatin A) and work rapidly at low temperatures.

  • Genomic complexity interference:

    • Challenge: The highly rearranged genome may cause unexpected expression patterns or modifications.

    • Solution: Verify protein sequence by mass spectrometry and compare with predicted sequence from genomic data.

  • Purity assessment:

    • Challenge: Distinguishing CP47 from other PSII components.

    • Solution: Use a combination of techniques including SDS-PAGE, immunoblotting with specific antibodies, and mass spectrometry validation .

How can researchers design single-subject experimental protocols to study CP47 function in Trachelium caeruleum?

Single-subject experimental designs (SSEDs) can be effectively applied to CP47 research as follows:

  • Baseline-Intervention (A-B) Design:

    • Baseline (A): Measure photosynthetic parameters in wild-type Trachelium caeruleum plants.

    • Intervention (B): Apply specific treatments (e.g., point mutations, light conditions) and continue measurements.

    • This design allows researchers to detect changes in level, trend, or variability between phases .

  • Multiple Baseline Design:

    • Apply interventions to different plants at different times.

    • This controls for maturation and history effects that might confound results.

  • Alternating Treatments Design:

    • Rapidly alternate between treatment conditions to compare effects.

    • Particularly useful for comparing different light conditions or inhibitor treatments.

  • Visual analysis techniques:

    • Assess changes in level (shift in mean performance).

    • Evaluate trend changes (slope direction).

    • Examine variability patterns before and after intervention .

  • Data collection recommendations:

    • Collect at least 5 data points per phase.

    • Use consistent measurement techniques across phases.

    • Control environmental conditions (temperature, humidity, etc.).

These SSED approaches are especially valuable when working with rare or difficult-to-culture species like Trachelium caeruleum, where large sample sizes may be impractical .

What strategies can be employed to study the interaction between CP47 and other Photosystem II proteins in Trachelium caeruleum?

To study CP47 interactions with other PSII proteins in Trachelium caeruleum, researchers can employ these strategies:

  • Cross-linking mass spectrometry (XL-MS):

    • Apply chemical cross-linkers (e.g., BS3, DSS, EDC) to stabilize protein-protein interactions.

    • Digest cross-linked complexes and analyze by LC-MS/MS.

    • Map interaction interfaces by identifying cross-linked peptides.

  • Co-immunoprecipitation with specific antibodies:

    • Use anti-CP47 antibodies to pull down interacting partners.

    • Identify interacting proteins by mass spectrometry.

    • Available antibodies have confirmed cross-reactivity with Trachelium caeruleum proteins .

  • Split-reporter protein complementation assays:

    • Fuse candidate interacting proteins with complementary fragments of a reporter protein.

    • Reporter signal indicates interaction in vivo.

  • Bimolecular Fluorescence Complementation (BiFC):

    • Particularly useful for visualizing the subcellular location of interactions.

    • Can be applied in plant protoplasts or through stable transformation.

  • Surface Plasmon Resonance (SPR):

    • Quantitative measurement of binding kinetics between purified components.

    • Requires successful purification of multiple PSII components.

  • Cryo-EM structural analysis:

    • For high-resolution structural determination of the entire PSII complex.

    • Can reveal subtle differences in protein arrangements compared to other species.

These approaches should be complemented with comparative analyses using homologous proteins from plant species with conventional chloroplast genomes to identify Trachelium-specific interaction patterns .

How should researchers interpret differences in CP47 function between Trachelium caeruleum and model plant species?

When interpreting functional differences in CP47 between Trachelium caeruleum and model plants, researchers should consider:

  • Genomic context effects vs. protein sequence effects:

    • Determine whether differences arise from altered protein sequence or from changes in expression due to genomic rearrangements .

    • Create chimeric constructs with Trachelium CP47 in model plant genomic contexts to isolate these factors.

  • Evolutionary adaptation frameworks:

    • Consider whether differences represent neutral variations or adaptive changes.

    • Compare with CP47 from related species with different degrees of chloroplast genome rearrangement.

  • Statistical analysis recommendations:

    • Use phylogenetically corrected statistical methods to account for evolutionary relationships.

    • Apply multiple comparison corrections when comparing across several species.

    • Calculate effect sizes rather than relying solely on p-values.

  • Controlling for confounding variables:

    • Growth conditions (light intensity, temperature, humidity)

    • Developmental stage

    • Tissue specificity

  • Validation experiments:

    • Confirm in vitro observations with in vivo measurements.

    • Use complementation studies in model systems with CP47 mutations.

When properly contextualized, differences may provide insights into the structural flexibility of CP47 and the adaptive potential of photosynthetic proteins during evolutionary genomic rearrangements .

What bioinformatic approaches are most effective for analyzing the unique features of psbB in the context of Trachelium's rearranged chloroplast genome?

For analyzing psbB in Trachelium's rearranged genome, these bioinformatic approaches are most effective:

  • Comparative genomic analysis:

    • Use tools like MultiPipMaker and REPuter to identify repeated sequences and their relationship to rearrangement endpoints .

    • Compare synteny between Trachelium and other plants to identify conserved and disrupted gene clusters.

  • Phylogenetic footprinting:

    • Identify conserved regulatory elements despite genomic rearrangements.

    • Use tools like MEME, GLAM2, and FootPrinter for motif discovery.

  • RNA-seq data analysis:

    • Analyze transcriptome data to identify potential effects of rearrangements on psbB expression.

    • Compare with model species to detect differential expression patterns.

  • Structural prediction and comparison:

    • Use homology modeling to predict CP47 structure based on crystallographic data from model organisms.

    • Compare predicted structures to identify potential functional differences.

  • Network analysis:

    • Construct co-expression networks to identify genes whose expression correlates with psbB.

    • Compare these networks between Trachelium and other species to identify differences in gene regulation.

  • Repeat analysis:

    • Use specialized tools like REPuter to characterize the repeats found near psbB and at inversion endpoints .

    • Categorize repeats by size, sequence, and potential origin (gene fragments, tRNAs, etc.).

These approaches should be integrated to develop a comprehensive understanding of how the genomic context affects psbB structure, expression, and function.

How can researchers distinguish between experimental artifacts and true biological variations when studying recombinant CP47 from Trachelium caeruleum?

To distinguish artifacts from true biological variations, researchers should implement:

  • Comprehensive controls matrix:

Control TypePurposeImplementation
Expression system controlsAccount for host-specific effectsExpress the same protein in multiple systems (E. coli, yeast, insect cells)
Tag position controlsAssess tag interferenceCompare N-terminal, C-terminal, and tagless constructs
Purification method controlsIdentify method-induced artifactsCompare different purification strategies (affinity, ion exchange, size exclusion)
Native protein comparisonBaseline for recombinant proteinExtract native protein from Trachelium when possible
Cross-species validationDistinguish species-specific featuresPerform parallel experiments with CP47 from model species
  • Statistical validation approaches:

    • Biological replicates (minimum n=3) with independent protein preparations

    • Technical replicates to assess measurement variability

    • Appropriate statistical tests with correction for multiple comparisons

  • Orthogonal method validation:

    • Confirm key findings using fundamentally different experimental approaches

    • Example: Validate binding interactions observed in pull-down assays using microscopy or spectroscopic methods

  • Consistency checks:

    • Compare results to theoretical predictions based on sequence

    • Assess agreement with known properties of CP47 from other species

    • Verify that observed differences make biological/evolutionary sense

  • Dose-response relationships:

    • Test whether effects change predictably with experimental conditions

    • Non-linear or inconsistent responses may indicate artifacts

By systematically implementing these strategies, researchers can build confidence in identifying true biological variations in Trachelium caeruleum CP47 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.