Recombinant Trachypithecus auratus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Recombinant Trachypithecus auratus MC1R shares functional properties with human and murine homologs:

  • Ligand Binding: Activates cAMP signaling upon binding α-MSH or ACTH .

  • Melanin Regulation: Modulates eumelanin (dark pigment) synthesis via cAMP-dependent pathways .

  • Desensitization: Undergoes GRK6-mediated phosphorylation (e.g., T308, S316) and β-arrestin-dependent internalization .

Key Mutational Effects (inferred from orthologs):

  • Loss-of-function mutations (e.g., RHC variants): Reduce receptor activity, increasing pheomelanin production .

  • Conserved cysteine residues: Critical for structural integrity; mutations disrupt ligand affinity and signaling .

Table 1: Applications of Recombinant MC1R in Biomedical Research

ApplicationExperimental UseReference
Melanogenesis StudiesElucidating pigment-type switching mechanisms in non-human primates
Drug ScreeningTesting MC1R-targeted therapies for melanoma or vitiligo
Evolutionary BiologyComparative analysis of MC1R adaptation in high-UV environments
Structural BiologyCryo-EM or X-ray crystallography to resolve receptor-ligand interaction mechanisms

Comparative Analysis with Other Primates

MC1R sequences across primates reveal evolutionary conservation:

  • Golden lion tamarin (Leontopithecus rosalia): 98% amino acid identity with T. auratus MC1R .

  • Humans: Key differences in the C-terminal tail affect desensitization kinetics .

Challenges and Future Directions

  • Functional Assays: Direct validation of ligand-binding kinetics in T. auratus MC1R remains pending .

  • Pathogenicity: Role of MC1R variants in Javan langur pigmentation disorders is unexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Trachypithecus auratus (Javan langur)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV VAIARNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLRRARRVVAAIWVASVLFSTLFI AYCDHAAVLLSLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGVGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKKVLLCSW
Uniprot No.

Target Background

Function
This receptor acts as a receptor for Melanocyte-stimulating hormone (MSH, alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. It regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by controlling cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MC1R and what are its fundamental functions in primates?

MC1R (Melanocortin 1 Receptor) is a G protein-coupled receptor with seven transmembrane domains that plays a crucial role in regulating pigmentation in mammals. In primates like Trachypithecus auratus, MC1R functions primarily by binding alpha-melanocyte-stimulating hormone (α-MSH), which activates the cAMP pathway leading to melanin production . Beyond pigmentation, MC1R signaling has significant implications for immune function, as it mediates α-MSH's antiinflammatory and immunomodulatory effects . Recent studies have revealed that α-MSH/MC1R-mediated signaling is critical for the induction of cytotoxicity in CD8+ T cells, indicating its broader physiological significance beyond pigmentation alone .

How does recombinant MC1R protein structure differ between Trachypithecus species?

The full-length MC1R protein in Trachypithecus obscurus consists of 317 amino acids with seven transmembrane domains, similar to what would be expected in T. auratus . Structural analysis reveals a conserved architecture including an N-terminus, seven transmembrane helices (labeled I-VII), and a C-terminus containing an amphipathic helix 8 (fourth intracellular loop) that includes many conserved basic residues . Specific variations between species often occur in the C-terminal region, where mutations like R307G (identified in Neanderthals) can significantly affect receptor function through partial loss of activity . These structural differences between closely related species provide valuable insights into the evolutionary adaptation of pigmentation mechanisms.

What reconstitution and storage protocols ensure optimal MC1R stability?

Recombinant MC1R proteins are typically supplied as lyophilized powder and should be briefly centrifuged prior to opening to ensure all material is at the vial bottom . Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, the addition of glycerol to a final concentration of 30-50% is recommended, followed by aliquoting to avoid repeated freeze-thaw cycles . Storage at -20°C/-80°C is optimal for preserved activity, while working aliquots can be maintained at 4°C for up to one week . These protocols help maintain protein structure and function, particularly important for transmembrane proteins like MC1R that are prone to aggregation.

How can researchers assess MC1R functionality in experimental systems?

Functional characterization of MC1R requires assays that measure cAMP accumulation following agonist stimulation, as the MC1R signaling pathway acts primarily through cAMP-dependent mechanisms . This methodology has been effectively demonstrated in studies comparing wild-type and variant MC1R activity, such as the R307G variant found in Neanderthals . A standard functional assay protocol involves:

  • Transient transfection of expression constructs (MC1R wild-type or variants) into appropriate cell lines

  • Treatment with α-MSH at various concentrations (typically 10^-10 to 10^-6 M)

  • Measurement of intracellular cAMP accumulation using ELISA or other quantitative methods

  • Inclusion of appropriate controls (e.g., cells transfected with GFP alone)

  • Analysis of dose-response relationships to determine EC50 values

This approach allows for comparative analysis of receptor variants and assessment of partial or complete loss of function mutations .

What role does MC1R play in DNA repair mechanisms?

Recent evidence indicates that MC1R signaling enhances DNA repair pathways, independent of its effects on melanogenesis . α-MSH has been shown to protect keratinocytes from UVB-induced DNA damage through a mechanism involving the modulation of DNA repair molecules . This process is MC1R-dependent, as demonstrated through siRNA knockdown experiments where the protective effect of α-MSH was abolished following MC1R silencing . The mechanism involves α-MSH-mediated activation of XAB1, which subsequently promotes XPA nuclear translocation, enhancing nucleotide excision repair capacity . These findings suggest an evolutionarily conserved role for MC1R in genomic protection beyond its classical pigmentation function.

How do MC1R variants impact immunological pathways in primates?

MC1R variants can significantly alter immune responses, particularly in cytotoxic T cell function. Research has demonstrated that α-MSH/MC1R-mediated signaling is critical for the induction of cytotoxicity in CD8+ T cells . When this signaling pathway is functional, it leads to:

  • Enhanced expression of cytotoxic genes in tumor-specific CD8+ T cells

  • Increased cytolytic activity against target cells

  • Augmented antitumoral immunity

  • Modulation of contact allergy responses

Conversely, in individuals with nonfunctional MC1R variants, the cytotoxic capacity of CD8+ T cells may be compromised, potentially impacting both antitumor immunity and inflammatory responses . This demonstrates the pleiotropic effects of MC1R beyond pigmentation and highlights its importance in immunomodulation.

What strategies can improve the expression and purification of recombinant MC1R?

As a seven-transmembrane G protein-coupled receptor, MC1R presents significant challenges for recombinant expression and purification. To optimize these processes:

StrategyImplementationAdvantage
Codon optimizationAdapt codon usage to expression hostImproves translation efficiency
Fusion tagsN-terminal His tag with precision protease cleavage siteFacilitates purification while allowing tag removal
Detergent screeningTest multiple detergents (DDM, LMNG, GDN)Identifies optimal conditions for protein solubilization
Expression temperatureReduce to 16-18°C post-inductionPromotes proper folding
Lipid supplementationAdd cholesterol or specific phospholipidsStabilizes transmembrane domains

For Trachypithecus MC1R specifically, E. coli expression systems have been successfully employed with N-terminal His tags, though mammalian expression systems may provide better functional protein for certain applications .

What experimental approaches can assess MC1R's role in melanogenesis versus immunomodulation?

To dissect the dual roles of MC1R in pigmentation and immune function, researchers should design experiments that can separate these pathways:

  • Cell type-specific approaches: Compare MC1R function in melanocytes versus immune cells (CD8+ T cells) using the same ligands and activation conditions .

  • Pathway-specific inhibitors: Employ selective inhibitors of downstream signaling components to determine which pathways are essential for different MC1R functions.

  • Domain-specific mutations: Create targeted mutations in different receptor domains to identify regions critical for binding α-MSH versus regions involved in coupling to different signaling pathways.

  • Temporal analysis: Study the kinetics of different responses (melanogenesis versus immune activation) following MC1R stimulation to determine if these processes operate on different time scales.

  • In vivo models: Utilize conditional knockout approaches to ablate MC1R function in specific cell types or at specific developmental stages .

How can CRISPR-Cas9 be optimized for studying MC1R function in primate cells?

CRISPR-Cas9 gene editing offers powerful approaches for investigating MC1R function in primate cells through:

  • Guide RNA design: Target conserved functional domains using multiple sgRNAs with high specificity scores and minimal off-target effects. For primate MC1R, conserved regions within transmembrane domains or ligand-binding sites should be prioritized.

  • Homology-directed repair templates: Design templates containing specific mutations of interest (e.g., corresponding to natural variants) flanked by 800-1000 bp homology arms.

  • Validation strategies: Implement comprehensive validation including sequencing, Western blotting, and functional assays (cAMP accumulation) to confirm both genetic and functional alterations.

  • Phenotypic assays: Develop quantitative assays for melanin production, DNA repair capacity, and immune function to assess the multifaceted consequences of MC1R modifications.

  • Single-cell approaches: Employ single-cell RNA-seq to characterize the full spectrum of pathway alterations resulting from MC1R editing, revealing unexpected or compensatory mechanisms.

How should discrepancies between in vitro and in vivo MC1R functional studies be reconciled?

Researchers frequently encounter discrepancies between in vitro MC1R functional assays and in vivo phenotypic observations. To address these challenges:

  • Context dependency: Recognize that MC1R function is highly context-dependent, with activity modulated by cell type, ligand concentration, and presence of auxiliary proteins .

  • Compensatory mechanisms: In vivo systems may activate compensatory pathways that mask the effects of MC1R dysfunction observed in simplified in vitro systems .

  • Temporal dynamics: Consider that acute in vitro responses may differ significantly from long-term adaptations in vivo. For example, α-MSH-mediated protection against UV damage shows different temporal dynamics in isolated keratinocytes versus intact skin .

  • Integrative analysis: Combine data from multiple experimental approaches (in vitro receptor activity, ex vivo tissue culture, and in vivo models) to develop comprehensive models of MC1R function.

  • Physiological ligand concentrations: Ensure in vitro studies employ ligand concentrations that reflect physiological ranges rather than saturating doses that may obscure subtle functional differences between variants .

What evolutionary insights can MC1R comparative genomics provide?

Comparative genomic analysis of MC1R across primates and other species reveals significant evolutionary insights:

  • Convergent evolution: Independent evolution of inactive MC1R variants in different lineages suggests parallel evolutionary pressures, as observed between modern humans and Neanderthals .

  • Functional conservation: Despite sequence divergence, functional domains of MC1R show remarkable conservation across species, indicating strong selective pressure on core receptor functions .

  • Adaptive significance: Depigmentation associated with MC1R variants appears to have evolved independently in multiple lineages, suggesting adaptive value beyond simple loss of function .

  • Pleiotropic effects: The diverse roles of MC1R in pigmentation, DNA repair, and immunity suggest that selection on one function may have collateral effects on others, complicating the evolutionary interpretation of MC1R variants .

  • Molecular mechanisms: Comparative analysis reveals diverse mechanisms for MC1R inactivation, including frameshift mutations (as in Pachón cave fish) and point mutations (as in Yerbaniz/Japonés cave populations and Neanderthals) .

How can functional assays for MC1R variants be standardized across research groups?

Standardization of MC1R functional assays is essential for reliable cross-study comparisons. Key recommendations include:

  • Reference standards: Include well-characterized MC1R variants (e.g., complete loss-of-function and partial loss-of-function mutations) as internal controls in all experiments .

  • Assay validation: Validate cAMP accumulation assays using dose-response curves with defined EC50 values and expression level controls .

  • Expression normalization: Quantify receptor expression levels through Western blotting or flow cytometry and normalize functional responses accordingly.

  • Cellular context: Specify and standardize cellular backgrounds for heterologous expression, as different cell types may contain varying levels of signaling components.

  • Multi-parameter assessment: Evaluate multiple functional outcomes, including cAMP production, ERK activation, and calcium mobilization, to fully characterize receptor functionality.

  • Reproducibility practices: Implement robust statistical approaches and minimal reporting standards, including detailed methodological descriptions that allow for exact replication.

What emerging technologies will advance MC1R research in primates?

Several cutting-edge technologies are poised to transform MC1R research in primate systems:

  • Cryo-EM structural analysis: Determination of high-resolution structures of primate MC1R in complex with ligands and signaling partners will provide unprecedented insights into functional mechanisms.

  • Organoid models: Development of skin and immune organoids from primates with different MC1R variants will enable complex functional studies in physiologically relevant three-dimensional contexts.

  • Single-cell multi-omics: Integration of transcriptomics, proteomics, and metabolomics at single-cell resolution will reveal cell type-specific effects of MC1R variants within heterogeneous tissues.

  • In vivo imaging: Advanced molecular imaging techniques using labeled ligands will allow real-time visualization of MC1R dynamics in living systems.

  • Systems biology approaches: Computational modeling of MC1R-dependent networks will help predict the complex interplay between pigmentation, immune function, and DNA repair pathways.

How can MC1R research inform therapeutic approaches for immune and pigmentation disorders?

Understanding MC1R function has significant implications for therapeutic development:

  • T cell engineering: Insights into MC1R-mediated enhancement of CD8+ T cell cytotoxicity could inform the development of more effective cancer immunotherapies .

  • DNA repair enhancement: The role of α-MSH in promoting DNA repair suggests therapeutic applications for preventing UV-induced skin damage and potentially reducing skin cancer risk .

  • Targeted immunomodulation: MC1R agonists could be developed as novel treatments for inflammatory conditions, capitalizing on the anti-inflammatory properties of α-MSH signaling .

  • Personalized approaches: Genetic screening for MC1R variants could identify individuals who might benefit from specialized preventive measures against UV damage or tailored immunotherapeutic approaches .

  • Structure-based drug design: With improved structural understanding of primate MC1R variants, selective agonists could be designed to target specific functions while minimizing unwanted effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.