Recombinant Trachypithecus cristatus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

Recombinant MC1R binds melanocortins (e.g., α-MSH) and adrenocorticotropic hormone (ACTH), activating cAMP signaling via Gs proteins . Functional assays reveal:

  • Basal activity: Constitutive signaling observed in primate MC1R homologs, independent of ligand binding .

  • Agonist response: Dose-dependent cAMP elevation (EC₅₀ ~10⁻⁸–10⁻⁷ M α-MSH) .

  • Antagonist interaction: Agouti signaling protein (ASIP) inhibits receptor activity even in MSH-binding-deficient variants .

Table 1: Key Studies Involving Recombinant MC1R

Study FocusMethodologyKey FindingsReference
Evolutionary divergenceComparative sequencingHigh basal cAMP activity in T. cristatus MC1R compared to New World monkeys
Melanogenesis regulationcAMP assaysReduced surface expression in high-elevation variants correlates with lighter pigmentation
Pharmacological profilingLigand-binding assaysLoss of MSH binding in lemur lineage, retained ASIP inhibition

Notable Observations:

  • Pigmentation linkage: MC1R variants with reduced cell-surface expression (e.g., due to C35 mutations) correlate with lighter dorsal melanin in primates .

  • Dimerization: Constitutive homo-dimerization via disulfide bonds is essential for trafficking to the plasma membrane .

Comparative Analysis with Human MC1R

FeatureTrachypithecus cristatus MC1RHuman MC1R
Amino acid length310317
Key polymorphismsNone reportedR151C, R160W, D294H linked to red hair phenotype
Basal cAMP activityModerateLow (requires agonist stimulation)
ASIP inhibitionRetainedRetained

Limitations and Research Gaps

  • Species-specific data: Functional studies primarily focus on human, murine, or non-Trachypithecus primate MC1R .

  • Structural models: No crystallography or cryo-EM data exist for T. cristatus MC1R .

Future Directions

  • Site-directed mutagenesis: Validate roles of residues C35 and E94K in constitutive activity .

  • Climate adaptation studies: Link MC1R variants to UV resistance in T. cristatus habitats .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Trachypithecus cristatus (Silvered leaf-monkey) (Presbytis cristata)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV VAIARNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLRRARRVVAAIWVASVLFSTLFI AYCDHAAVLLSLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGVGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKKVLLCSW
Uniprot No.

Target Background

Function
This receptor binds to Melanocyte-stimulating hormone (MSH) (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. It regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by controlling cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MC1R receptor and what cellular functions does it regulate?

The MC1R (Melanocyte-stimulating hormone receptor) is a G protein-coupled receptor expressed on the surface of melanocytes that plays a crucial role in mammalian pigmentation. MC1R responds to melanocyte-stimulating hormone (MSH) to activate specific signaling pathways that stimulate the production of eumelanin (black/brown pigment) rather than pheomelanin (yellow/red pigment) . Beyond pigmentation, MC1R signaling through the MITF transcription factor affects multiple cellular processes including DNA repair (via genes such as APEX1), cell cycle regulation (via CDKN2A and CDK2), apoptosis (via BCL2), and cellular invasion (via DIA1) . This multi-functionality makes MC1R a research target not only for understanding pigmentation but also for investigating cellular responses to environmental stressors such as UV radiation.

How can the Trachypithecus cristatus MC1R gene be cloned for recombinant expression studies?

For cloning the Trachypithecus cristatus MC1R gene, researchers should first isolate high-quality genomic DNA from tissue samples (skin biopsies are often preferred). PCR amplification using primers designed from conserved regions of primate MC1R sequences is the recommended approach. The methodology involves:

  • Design primers based on alignment of MC1R sequences from closely related primate species

  • Amplify the complete coding sequence using high-fidelity DNA polymerase

  • Validate amplicons by sequencing before insertion into an expression vector

  • Clone the validated sequence into an appropriate expression vector containing:

    • A strong promoter (CMV for mammalian expression; T7 for bacterial expression)

    • A purification tag (His-tag, FLAG-tag, or GST-tag)

    • Appropriate selection markers

This approach has been successful for cloning human and mouse MC1R genes, which have been characterized pharmacologically and show sensitivity to alpha-MSH and other ligands .

What are the key methodological considerations when attempting to express functional recombinant MC1R?

Expressing functional recombinant MC1R presents several challenges that researchers must address:

  • Expression system selection: Mammalian expression systems (HEK293, CHO cells) are strongly preferred over bacterial systems due to the requirement for post-translational modifications and proper membrane insertion.

  • Membrane protein solubilization: MC1R is a seven-transmembrane domain protein that requires careful solubilization with detergents when purified. Consider using:

    • Mild detergents like DDM or LMNG

    • Lipid nanodiscs for maintaining native-like membrane environment

    • Addition of cholesterol to stabilize the receptor

  • Functional validation approaches:

    • cAMP accumulation assays (MC1R activates adenylyl cyclase)

    • Calcium mobilization assays

    • β-arrestin recruitment assays

    • Binding assays using radiolabeled or fluorescently labeled ligands

  • Storage conditions: Include stabilizing agents (glycerol, specific lipids) and appropriate pH buffers to maintain receptor functionality during storage.

When characterizing recombinant MC1R, pharmacological profiling with known ligands is essential, as demonstrated in studies comparing human and mouse MC1R where differences in sensitivity to alpha-MSH, ACTH, and Lys gamma 3-MSH were observed .

How do MC1R variants affect downstream signaling pathways in different species, and what methodologies best capture these differences?

MC1R variants significantly impact downstream signaling through the MITF pathway, affecting multiple cellular processes including pigmentation, DNA repair, apoptosis, and proliferation. To effectively study these differences:

  • Employ phosphoproteomic approaches to map the complete signaling cascade, capturing:

    • Phosphorylation events following receptor activation

    • Temporal dynamics of signaling using pulse-chase experiments

    • Pathway crosstalk with other cellular signaling networks

  • Utilize CRISPR-Cas9 gene editing to:

    • Generate isogenic cell lines with specific MC1R variants

    • Create cell models expressing Trachypithecus cristatus MC1R variants

    • Introduce reporter constructs for real-time signaling visualization

  • Apply RNA-seq and ChIP-seq methodologies to:

    • Identify differentially expressed genes following MC1R activation

    • Map MITF binding sites in response to MC1R signaling

    • Compare transcriptional programs between species and variants

Research has shown that MC1R variants modulate MITF transcription factor signaling, which in turn affects tumor cell proliferation, apoptosis, and DNA repair processes . When comparing between species, human MC1R shows higher sensitivity to alpha-MSH (EC50 = 2 pM) and ACTH (EC50 = 8 pM) compared to mouse MC1R, suggesting different signaling thresholds and potentially distinct downstream effects .

What strategies can resolve contradictory findings when comparing MC1R functions across species?

When faced with contradictory findings in cross-species MC1R functional comparisons, researchers should implement these methodological approaches:

  • Standardize experimental conditions:

    • Use identical expression systems for all MC1R orthologs

    • Ensure equivalent receptor expression levels (verified by Western blotting)

    • Apply consistent ligand concentrations and exposure times

    • Control for differences in G-protein coupling efficiency

  • Employ domain-swapping experiments:

    • Create chimeric receptors exchanging key domains between species

    • Systematically test extracellular loops, transmembrane domains, and intracellular regions

    • Use site-directed mutagenesis to identify key residues responsible for functional differences

  • Apply advanced statistical analyses:

    • Conduct meta-analyses of published data with appropriate weighting

    • Use Bayesian approaches to incorporate prior knowledge

    • Apply sensitivity analyses to identify variables driving contradictory results

  • Consider evolutionary context:

    • Analyze selection pressures on MC1R across primates

    • Correlate functional differences with ecological niches and UV exposure

    • Evaluate convergent evolution patterns in MC1R across diverse species

Studies comparing human and mouse MC1R have revealed significant differences in ligand sensitivity despite structural similarities, highlighting the importance of careful cross-species comparisons .

How can protein modeling techniques be applied to predict functional differences between human and Trachypithecus cristatus MC1R?

Computational modeling of MC1R provides valuable insights when direct experimental data is limited. For comparing human and Trachypithecus cristatus MC1R:

  • Apply homology modeling approaches:

    • Use crystal structures of related GPCRs as templates

    • Incorporate sequence alignments to identify conserved motifs

    • Validate models through energy minimization and Ramachandran plot analysis

  • Conduct molecular dynamics simulations to:

    • Analyze receptor stability in membrane environments

    • Predict ligand binding pocket conformations

    • Identify species-specific differences in receptor flexibility

    • Simulate interactions with different ligands (alpha-MSH, ACTH, synthetic analogs)

  • Implement protein-ligand docking studies:

    • Compare binding affinities across species

    • Identify key residues involved in ligand recognition

    • Calculate binding energy differences between variants

  • Use machine learning approaches to:

    • Predict functional consequences of sequence variations

    • Classify variants based on potential signaling impacts

    • Identify novel potential binding partners

These computational predictions should guide experimental design, particularly when deciding which receptor regions to target for site-directed mutagenesis or which ligands may show species-specific effects.

What are the optimal assays for measuring MC1R activation and signaling in different experimental systems?

Researchers studying MC1R signaling should select assays based on the specific pathway and time scale of interest:

  • Primary signaling assays (seconds to minutes):

    • cAMP accumulation: Measured using ELISA, FRET-based sensors, or radiolabeled cAMP

    • Calcium flux: Monitored with fluorescent calcium indicators (Fluo-4, Fura-2)

    • ERK phosphorylation: Detected via Western blotting or phospho-specific antibodies

  • Downstream signaling assays (minutes to hours):

    • MITF nuclear translocation: Visualized using immunofluorescence or MITF-GFP fusions

    • Transcriptional activation: Measured using luciferase reporter constructs

    • Gene expression changes: Quantified through qRT-PCR or RNA-seq

  • Functional outcome assays (hours to days):

    • Melanin production: Quantified spectrophotometrically

    • Dendrite formation: Assessed through morphological analysis

    • Cell proliferation/apoptosis: Measured using MTT assays, flow cytometry

  • Recommended experimental controls:

    • Positive control: NDP-MSH (super potent analog of alpha-MSH)

    • Negative control: MC1R antagonists or cells lacking MC1R expression

    • Pathway validation: PKA inhibitors, adenylyl cyclase inhibitors

For maximum sensitivity when measuring MC1R activation, researchers should note that human MC1R responds to alpha-MSH with an EC50 of approximately 2 pM and to ACTH with an EC50 of approximately 8 pM .

How should researchers design experiments to investigate the role of MC1R in DNA repair mechanisms?

To investigate MC1R's role in DNA repair, researchers should implement a multi-faceted experimental approach:

  • DNA damage induction protocols:

    • UV irradiation (most physiologically relevant)

    • Chemical DNA damaging agents (H2O2 for oxidative damage)

    • Ionizing radiation (for double-strand breaks)

  • DNA repair capacity measurement methods:

    • Comet assay: Quantifies DNA strand breaks and repair kinetics

    • Immunofluorescence detection of γH2AX foci: Measures double-strand break repair

    • ELISA-based assays for oxidative DNA damage products (8-oxo-dG)

    • Host cell reactivation assays with damaged reporter plasmids

  • Experimental design structure:

    • Compare isogenic cell lines expressing different MC1R variants

    • Utilize MC1R agonists (α-MSH) and antagonists to modulate signaling

    • Include positive controls (cells with known DNA repair deficiencies)

    • Measure repair kinetics at multiple timepoints (0-24h post-damage)

  • Mechanistic investigations:

    • ChIP assays to assess recruitment of repair factors to damaged DNA

    • Co-immunoprecipitation to identify MC1R-interacting repair proteins

    • siRNA knockdown of APEX1 and other candidate repair genes

Research has shown that MC1R activation influences DNA repair through the regulation of APEX1, which is important in DNA repair responses to reactive oxygen species and oxidative DNA damage . Additionally, human melanocytes with two red hair color-associated MC1R alleles have been shown to be resistant to α-melanocortin (α-MSH)-mediated DNA repair .

What experimental approaches best elucidate the evolutionary differences in MC1R function across primate species?

To investigate evolutionary differences in MC1R function across primates including Trachypithecus cristatus:

  • Comparative genomics approaches:

    • Sequence multiple primate MC1R genes, including from:

      • Great apes (human, chimpanzee, gorilla)

      • Old World monkeys (including Trachypithecus cristatus)

      • New World monkeys

    • Calculate dN/dS ratios to identify sites under positive selection

    • Map variants onto structural models to predict functional impacts

  • Functional characterization methodologies:

    • Express MC1R from multiple primate species in the same cellular background

    • Measure dose-response curves for various ligands:

      • α-MSH

      • ACTH

      • β-defensin 3

      • Agouti signaling protein

    • Quantify differences in signaling magnitude, kinetics, and ligand preferences

  • Ecological correlation analyses:

    • Associate MC1R sequence variations with:

      • Natural habitat (UV exposure levels)

      • Fur/skin coloration patterns

      • Geographical distribution

Primate Speciesα-MSH Sensitivity (EC50)ACTH Sensitivity (EC50)Key Functional Variants
Human2 pM8 pMMultiple "R" and "r" variants
MouseLess sensitive than humanLess sensitive than humanFewer functional variants
Trachypithecus cristatusTo be determinedTo be determinedTo be determined

This table format can be used to compare sensitivities across species as data becomes available. Studies comparing human and mouse MC1R have already revealed significant functional differences, with human MC1R showing higher sensitivity to alpha-MSH, ACTH, and Lys gamma 3-MSH .

How should researchers analyze MC1R variant effects on cell signaling pathways?

Analyzing MC1R variant effects on signaling requires sophisticated quantitative approaches:

  • Dose-response analysis methodologies:

    • Calculate EC50 values using non-linear regression models

    • Compare Emax (maximum efficacy) values between variants

    • Evaluate response kinetics through area-under-curve calculations

    • Use appropriate statistical tests (ANOVA with post-hoc tests) for multi-variant comparisons

  • Pathway analysis approaches:

    • Apply principal component analysis to identify major patterns in signaling data

    • Use hierarchical clustering to group MC1R variants by signaling profile

    • Implement pathway enrichment analysis for downstream gene expression changes

    • Consider Bayesian network analysis to infer causal relationships

  • Data visualization recommendations:

    • Create heat maps showing relative activation across multiple pathways

    • Generate kinetic profiles with error bands rather than single timepoint data

    • Use Forest plots for meta-analysis of variant effects across studies

  • Interpretation frameworks:

    • Consider allosteric effects that may affect some pathways but not others

    • Evaluate biased signaling (differential activation of G-protein vs. β-arrestin pathways)

    • Account for receptor expression levels when comparing variant effects

Studies have shown that MC1R variants affect multiple pathways, including DNA repair through APEX1, cell cycle regulation through CDKN2A and CDK2, apoptosis through BCL2, and invasion through DIA1 .

What statistical approaches should be used when analyzing survival data in relation to MC1R genotypes?

When analyzing survival data in relation to MC1R genotypes, as in melanoma studies:

  • Primary statistical methods:

    • Cox proportional hazards models to estimate hazard ratios

    • Kaplan-Meier survival analysis with log-rank tests for between-group comparisons

    • Competing risk analysis when multiple outcome events are possible

  • Covariate selection and adjustment:

    • Include established prognostic factors (age, sex, tumor characteristics)

    • Consider stratification by known risk factors

    • Test for interaction effects between MC1R variants and other factors

  • MC1R variant scoring approaches:

    • Categorical classification (consensus vs. non-consensus alleles)

    • Weighted scoring systems based on variant functional impact

    • Consideration of specific variant combinations

  • Multi-cohort analysis strategies:

    • Fixed-effects or random-effects meta-analysis models

    • Forest plots to visualize hazard ratios across cohorts

    • Tests for between-study heterogeneity (Cochran's Q test)

How can researchers effectively compare functional differences between recombinant MC1R proteins from different species?

When comparing recombinant MC1R proteins from different species like human and Trachypithecus cristatus:

  • Receptor expression normalization methods:

    • Quantify surface expression using flow cytometry with tagged receptors

    • Perform radioligand binding assays to determine Bmax values

    • Use Western blotting with species-invariant epitope antibodies

    • Calculate signaling responses per receptor molecule rather than per cell

  • Functional parameter comparison approaches:

    • Generate complete concentration-response curves for multiple ligands

    • Calculate and compare potency (EC50) and efficacy (Emax) parameters

    • Analyze signaling kinetics (onset, duration, termination rates)

    • Evaluate relative signaling through different downstream pathways

  • Data representation best practices:

    • Present raw data alongside normalized results

    • Use radar charts to display multi-parameter functional fingerprints

    • Create correlation matrices to identify relationships between parameters

    • Apply principal component analysis to visualize multidimensional data

  • Statistical considerations:

    • Use paired experimental designs when possible

    • Apply ANOVA with appropriate post-hoc tests for multi-species comparisons

    • Calculate effect sizes (Cohen's d) to quantify magnitude of differences

    • Consider hierarchical linear modeling for complex experimental designs

Studies comparing human and mouse MC1R have shown that while both receptors respond similarly to the super potent NDP-MSH (EC50 = 1-2 pM), they differ significantly in their responsiveness to natural ligands, with human MC1R showing much higher sensitivity to alpha-MSH and ACTH .

How might research on Trachypithecus cristatus MC1R inform our understanding of primate adaptation to diverse environments?

Studying Trachypithecus cristatus MC1R provides a unique window into primate adaptation:

  • Ecological adaptation research approaches:

    • Correlate MC1R sequence variants with habitat parameters:

      • UV exposure levels in native range

      • Seasonal variation in environmental conditions

      • Predation pressure (camouflage requirements)

    • Compare Trachypithecus cristatus MC1R with related species inhabiting different niches

    • Analyze selection signatures in MC1R across the Trachypithecus genus

  • Physiological adaptation investigation methods:

    • Characterize melanin production and distribution in response to MC1R activation

    • Measure UV resistance of melanocytes expressing different MC1R variants

    • Evaluate thermal regulation aspects of pigmentation controlled by MC1R

  • Evolutionary context analysis:

    • Reconstruct ancestral MC1R sequences to track evolutionary changes

    • Identify convergent evolution patterns in primates from similar environments

    • Calculate evolutionary rates in different primate lineages

  • Translational implications:

    • Apply findings to conservation efforts for vulnerable primate species

    • Extract principles for understanding human pigmentation disorders

    • Develop insights into environmental adaptation mechanisms

The investigation of species-specific MC1R function has already revealed that different mammals show varying sensitivities to melanocortin peptides, suggesting adaptation to specific environmental or physiological needs .

What cellular assays can determine how MC1R variants impact DNA repair capacity across different species?

To assess how MC1R variants affect DNA repair across species:

  • UV-induced DNA damage repair assays:

    • Cyclobutane pyrimidine dimer (CPD) repair kinetics using specific antibodies

    • Removal of 6-4 photoproducts measured by ELISA or immunofluorescence

    • Unscheduled DNA synthesis assays to quantify nucleotide excision repair

  • Oxidative damage repair assessment:

    • 8-oxoguanine removal kinetics following oxidative stress

    • AP site (apurinic/apyrimidinic) quantification

    • APEX1 activity assays (particularly relevant as APEX1 is regulated by MITF)

  • Double-strand break repair evaluation:

    • γH2AX foci formation and resolution kinetics

    • Comet assay (neutral conditions) to measure double-strand break repair

    • Homologous recombination and non-homologous end joining reporter assays

  • Experimental design considerations:

    • Use isogenic cell lines expressing MC1R variants from different species

    • Test repair capacity with and without MC1R activation by α-MSH

    • Include positive controls (cells with known DNA repair deficiencies)

    • Perform time-course experiments to capture repair kinetics

Research has demonstrated that MC1R activation can mediate reduced oxidative DNA damage in melanocytes when exposed to UV radiation, and that human melanocytes with two red hair color-associated MC1R alleles are resistant to α-MSH-mediated DNA repair . These findings suggest that MC1R variants across species may show differential effects on DNA repair capacity.

DNA Repair PathwayAssay MethodKey Proteins InvolvedMC1R Influence
Nucleotide Excision RepairCPD removal kineticsXPA, XPC, ERCC1Modulated via MITF
Base Excision RepairAP site measurementAPEX1, OGG1, POLBDirect regulation of APEX1
Double-strand Break RepairγH2AX foci resolutionBRCA1, 53BP1, RAD51Indirect via cell cycle regulation

How can researchers design studies to investigate the therapeutic potential of targeting MC1R in various diseases?

Investigating MC1R as a therapeutic target requires systematic approaches:

  • Disease model selection strategies:

    • Pigmentation disorders (vitiligo, melasma)

    • Inflammatory conditions (based on MC1R's anti-inflammatory effects)

    • UV-induced skin damage and photoaging

    • Melanoma and other skin cancers

  • Therapeutic molecule screening approaches:

    • Develop high-throughput screening assays using:

      • cAMP accumulation readouts

      • β-arrestin recruitment

      • Receptor internalization

    • Test both orthosteric ligands and allosteric modulators

    • Consider biased ligands that selectively activate beneficial pathways

  • Preclinical efficacy study design:

    • Use genetically diverse models expressing different MC1R variants

    • Implement relevant disease endpoints (inflammation markers, DNA damage, tumor growth)

    • Include pharmacokinetic and pharmacodynamic assessments

    • Design combination studies with existing therapies

  • Translational considerations:

    • Develop companion diagnostics for MC1R genotyping

    • Plan for stratification of clinical trials based on MC1R variants

    • Consider topical vs. systemic delivery for skin-related indications

Research on MC1R variants has demonstrated that they affect multiple pathways relevant to disease, including DNA repair, apoptosis, and cell cycle regulation . Additionally, studies have shown that MC1R variants may influence melanoma survival, suggesting potential therapeutic implications .

What are the most promising future research directions for Trachypithecus cristatus MC1R studies?

The study of Trachypithecus cristatus MC1R offers several promising research avenues:

  • Evolutionary and ecological research:

    • Comparative analysis of MC1R across the entire Trachypithecus genus

    • Correlation of MC1R variants with coat color patterns and environmental factors

    • Investigation of selection pressures on MC1R in different primate lineages

  • Molecular and structural biology:

    • Determination of Trachypithecus cristatus MC1R crystal structure

    • Characterization of species-specific ligand binding properties

    • Identification of unique regulatory mechanisms

  • Functional genomics approaches:

    • CRISPR-mediated replacement of human MC1R with Trachypithecus cristatus variants

    • Single-cell transcriptomics to map downstream signaling effects

    • Epigenetic profiling to identify regulatory differences

  • Translational research potential:

    • Application of insights to human pigmentation disorders

    • Development of novel MC1R-targeted therapeutics based on species differences

    • Understanding of evolutionary adaptations relevant to human health

Current research on MC1R across species has already revealed significant functional differences, such as varying sensitivities to melanocortin peptides between human and mouse receptors , suggesting that further cross-species studies will continue to yield valuable insights into receptor function and evolution.

What methodological advances would most benefit the field of MC1R research?

Several methodological advances would significantly advance MC1R research:

  • Structural biology techniques:

    • Cryo-EM approaches for MC1R structure determination in different activation states

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Single-molecule FRET to study receptor dynamics in real-time

  • Advanced genetic tools:

    • Improved CRISPR base editing for precise MC1R variant generation

    • Inducible expression systems for temporal control of MC1R signaling

    • Transgenic animal models with humanized or Trachypithecus cristatus MC1R

  • Imaging and biosensor developments:

    • FRET/BRET-based sensors for real-time MC1R signaling in living cells

    • Super-resolution microscopy approaches for MC1R localization and trafficking

    • Multiplex imaging of multiple signaling pathways simultaneously

  • Computational and systems biology approaches:

    • Machine learning algorithms for predicting MC1R variant functional effects

    • Network analysis tools to map complete MC1R signaling networks

    • Molecular dynamics simulations with improved membrane protein parameters

These methodological advances would help address current knowledge gaps, such as the detailed structural basis for species differences in ligand sensitivity and the complex relationship between MC1R variants and downstream processes like DNA repair .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.