Recombinant Trachypithecus francoisi Melanocyte-stimulating hormone receptor (MC1R)

What is the Melanocyte-Stimulating Hormone Receptor (MC1R) and what is its function in Trachypithecus francoisi?

MC1R, also known as Melanocortin 1 Receptor, is a G protein-coupled receptor primarily expressed in melanocytes. In Trachypithecus francoisi (François' leaf monkey), the MC1R protein consists of 317 amino acids and functions as a critical regulator of melanogenesis. The receptor responds to melanocyte-stimulating hormone (MSH) binding by activating adenylyl cyclase, which increases intracellular cAMP levels and ultimately influences melanin production and distribution. This signaling pathway plays a crucial role in determining coat coloration patterns in primates, though specific phenotypic effects in T. francoisi are still being characterized through comparative studies with other primates .

How does the structure of Trachypithecus francoisi MC1R compare to human MC1R?

The recombinant full-length T. francoisi MC1R protein (Q864I4) spans 317 amino acids, similar to human MC1R which consists of 317-318 amino acids. Both share the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors. Sequence analysis reveals conserved functional domains including the ligand-binding pocket and G-protein interaction sites. The amino acid sequence of T. francoisi MC1R includes critical regions like "MPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVVVAIARNRNLHSPMYCFICCLALSDLLVSGSNMLDTAVILLLEAGALAARAAVVQQLDNVIDVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLRRARRVVAAIWVASILFSTLFIAYCDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGVGLKGAATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAFRSQELRRTLKKVLLCSW" . While sharing evolutionary conservation with human MC1R, specific amino acid variations may account for species-specific differences in ligand binding affinity and signaling efficiency.

How is recombinant Trachypithecus francoisi MC1R typically produced for research purposes?

Recombinant T. francoisi MC1R protein for research is typically produced using bacterial expression systems, particularly E. coli, with the addition of affinity tags such as His-tags for purification purposes. The production workflow involves:

• Gene synthesis or cloning of the T. francoisi MC1R coding sequence into an appropriate expression vector

• Transformation of the expression construct into competent E. coli cells

• Induction of protein expression under optimized conditions

• Cell lysis and protein extraction

• Affinity purification using His-tag binding to nickel columns

• Quality control assessment via SDS-PAGE (purity >90%)

• Lyophilization in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 for stability

This expression system yields functional recombinant protein suitable for various in vitro applications, though researchers should note that E. coli-expressed proteins lack post-translational modifications that might be present in the native protein.

What are the recommended reconstitution and storage protocols for recombinant Trachypithecus francoisi MC1R protein?

For optimal reconstitution and storage of lyophilized recombinant T. francoisi MC1R protein, researchers should follow these evidence-based protocols:

Reconstitution procedure:

• Centrifuge the vial briefly before opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (optimally 50%) to prevent freeze-thaw damage

• Aliquot into working volumes to minimize freeze-thaw cycles

Storage conditions:

• Long-term storage: -20°C to -80°C with glycerol as cryoprotectant

• Working aliquots: 4°C for up to one week

• Avoid repeated freeze-thaw cycles as this significantly decreases protein activity

The reconstituted protein maintains stability in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which protects the protein's native conformation and functional properties . For experiments requiring specific buffer conditions, researchers should perform buffer exchange using dialysis or filtration methods rather than direct dilution into assay buffers.

What binding assays are most effective for studying ligand interactions with recombinant MC1R?

Several binding assay methodologies have proven effective for studying ligand interactions with recombinant MC1R proteins:

Radioligand binding assays:

• Use of [125I]-labeled NDP-α-MSH or other melanocortin peptides

• Competition binding with unlabeled ligands to determine binding affinity (Kd, Ki values)

• Scatchard analysis for receptor density quantification

Fluorescence-based methods:

• FRET (Förster Resonance Energy Transfer) assays for real-time binding kinetics

• Fluorescently labeled ligands with confocal microscopy for visualization

• Time-resolved fluorescence for improved signal-to-noise ratio

Surface Plasmon Resonance (SPR):

• Label-free detection of binding events

• Determination of association/dissociation rate constants (kon/koff)

• Requires immobilization of either receptor or ligand on sensor chips

Functional assays:

• cAMP accumulation assays (primary signaling pathway)

• FLIPR calcium mobilization assays (secondary pathways)

• β-arrestin recruitment assays (downstream of receptor activation)

When designing these experiments with T. francoisi MC1R, researchers should consider the detergent environment needed to maintain receptor stability, as membrane proteins often require specific lipid or detergent micelles to retain native conformation and binding properties.

How can researchers effectively validate the functionality of recombinant Trachypithecus francoisi MC1R?

Validating the functionality of recombinant T. francoisi MC1R requires multifaceted approaches:

Structural validation:

• Circular dichroism (CD) spectroscopy to confirm secondary structure elements

• Size-exclusion chromatography to verify proper folding and aggregation state

• Western blotting with MC1R-specific antibodies to confirm identity

Functional validation:

• Ligand binding assays using natural (α-MSH) and synthetic agonists

• cAMP accumulation assays following receptor stimulation

• Downstream CREB phosphorylation detection via phospho-specific antibodies

• Calcium flux assays to detect secondary signaling pathways

Comparative validation:

• Parallel testing with human MC1R under identical conditions

• Dose-response curves to establish EC50/IC50 values

• Antagonist inhibition profiles to confirm pharmacological specificity

A comprehensive validation strategy should include concentration-dependent response curves to establish whether the recombinant protein exhibits expected pharmacological properties. Additionally, mutagenesis of key residues known to affect ligand binding can provide further evidence of functional integrity.

How does the Val60Leu variant observed in human MC1R compare to potential variants in Trachypithecus francoisi MC1R?

The Val60Leu variant in human MC1R represents an 'r' allele with weaker association to red hair phenotype compared to other variants, but has been significantly associated with increased nevus count, particularly in women . Although specific variants in T. francoisi MC1R have not been extensively characterized in the provided materials, comparative analysis can be approached through:

• Sequence alignment to determine if the equivalent position to human Val60 is conserved in T. francoisi MC1R

• Structural modeling to predict functional consequences of variations at this position

• Evolutionary analysis across primate species to determine selective pressures

Research indicates that MC1R variants can significantly impact phenotypic traits related to pigmentation. In humans, the Val60Leu variant demonstrates significant association with high nevus count (P = 0.017), with a particularly strong association among women (P < 0.001) . This sex-specific effect raises interesting questions about potential hormonal interactions with MC1R signaling that could be explored in T. francoisi models.

If researchers identify equivalent positions in T. francoisi MC1R, site-directed mutagenesis could be employed to study the functional consequences, potentially revealing evolutionary conservation or divergence of these mechanisms across primates.

What approaches can be used to study the role of MC1R in Trachypithecus francoisi pigmentation patterns?

Studying MC1R's role in T. francoisi pigmentation requires integrative approaches:

Genetic approaches:

• Sequencing MC1R genes from multiple T. francoisi individuals to identify natural polymorphisms

• Correlation of genetic variants with observed coat color variations

• Comparative genomics with closely related species showing different pigmentation patterns

Functional approaches:

• In vitro expression of wild-type and variant MC1R in melanocyte cell lines

• Measurement of melanin synthesis following receptor activation

• Signaling pathway analysis via phosphoproteomic methods

Tissue-level approaches:

• Immunohistochemistry to map MC1R expression in skin biopsies

• Quantification of eumelanin/pheomelanin ratios in hair samples

• Analysis of melanocyte distribution and dendricity in different body regions

Table 1: Comparative Analysis of MC1R Expression and Fur Coloration in Primates

This integrated approach would contribute significantly to understanding the evolutionary basis of primate pigmentation patterns and the specific role of MC1R in T. francoisi's distinctive black fur with white markings.

How can researchers effectively compare MC1R signaling pathways between Trachypithecus francoisi and human systems?

Comparative analysis of MC1R signaling between species requires systematic investigation of pathway components:

Primary signaling comparison:

• cAMP accumulation assays in parallel cell systems expressing either human or T. francoisi MC1R

• Dose-response curves with identical ligands to determine EC50 values

• Time-course studies to identify differences in signaling kinetics

G-protein coupling specificity:

• Co-immunoprecipitation studies to identify G-protein subtypes that interact with each receptor

• BRET/FRET assays to measure real-time coupling efficiency

• G-protein selective inhibitors to characterize pathway dependencies

Downstream effector analysis:

• Phosphorylation of CREB and other transcription factors

• Transcriptomic analysis to identify species-specific gene expression changes

• Metabolomic profiling to measure changes in melanin precursors

Pathway crosstalk investigation:

• Analysis of MAPK pathway activation

• Examination of calcium signaling components

• Determination of β-arrestin recruitment patterns

These comparative approaches should include appropriate controls and be conducted under standardized conditions to ensure valid cross-species comparisons. Researchers might consider using evolutionary conserved cell lines or developing species-specific cell models to accurately recapitulate the signaling environment.

What are the common challenges in expressing and purifying functional Trachypithecus francoisi MC1R protein, and how can they be addressed?

Researchers face several challenges when working with recombinant T. francoisi MC1R:

Challenge: Membrane protein solubility
Solution: Optimize detergent selection through screening panels (e.g., DDM, LMNG, CHS combinations). Consider using fusion partners like SUMO or MBP to enhance solubility, or employ nanodiscs or amphipols for detergent-free systems.

Challenge: Proper folding in E. coli
Solution: Express at lower temperatures (16-20°C), use specialized E. coli strains (Rosetta, Origami), or switch to eukaryotic expression systems like insect cells (Sf9/Sf21) or mammalian cells (HEK293, CHO) for improved folding and post-translational modifications.

Challenge: Low expression yields
Solution: Optimize codon usage for the expression host, use stronger promoters or inducible systems, and test different fusion tags. Consider implementing high-density fermentation techniques for improved biomass generation.

Challenge: Protein instability during purification
Solution: Include stabilizing additives (glycerol, specific lipids), maintain low temperature throughout purification, and minimize exposure to air/oxidation. Include protease inhibitors and perform rapid purification procedures.

Challenge: Functional validation
Solution: Develop robust activity assays specific to MC1R function, establish clear quality control metrics, and compare with well-characterized MC1R proteins from other species as benchmarks.

When working with His-tagged T. francoisi MC1R, researchers should consider imidazole concentration optimization during elution steps to minimize non-specific binding while maximizing target protein recovery .

How should researchers interpret differences in experimental data between recombinant MC1R and native receptor systems?

When interpreting discrepancies between recombinant and native MC1R systems:

Key considerations for data interpretation:

• Expression system differences:

  • E. coli-expressed proteins lack post-translational modifications

  • Mammalian cell expression provides more native-like modifications but may introduce host-specific alterations

  • Compare data across multiple expression systems to identify system-specific artifacts

• Protein conformation factors:

  • Presence/absence of native lipid environment affects receptor conformation

  • Detergent choice significantly impacts structural integrity and function

  • Affinity tags may sterically hinder certain interactions

• Signaling context variations:

  • Recombinant systems may lack cell-specific scaffolding proteins

  • G-protein stoichiometry differs between natural and recombinant systems

  • Downstream effector availability varies between experimental setups

• Quantitative adjustments:

  • Develop correction factors based on reference ligands with known properties

  • Use internal standards to normalize between different experimental systems

  • Consider allosteric modulators that may be present in native but not recombinant systems

Researchers should systematically document differences between systems and develop experimental designs that account for these variables, such as parallel testing with well-characterized reference compounds to establish system-specific baselines.

What are the best approaches for studying MC1R variant effects in evolutionary contexts?

To study MC1R variants in evolutionary contexts:

Methodological framework:

• Sequence-based approaches:

  • Perform phylogenetic analysis of MC1R across primate species

  • Identify sites under positive selection using dN/dS ratios

  • Map variants onto structural models to predict functional impacts

  • Use ancestral sequence reconstruction to infer evolutionary transitions

• Functional characterization:

  • Create recombinant proteins representing ancestral and derived states

  • Measure ligand binding affinity changes across variants

  • Quantify signaling pathway activation differences

  • Determine stability and expression level variations

• Ecological correlation:

  • Map MC1R variants to habitat types and predation pressures

  • Correlate pelage patterns with environmental factors

  • Consider UV radiation exposure in native habitats

  • Analyze polymorphism maintenance through balancing selection

• Evolutionary modeling:

  • Estimate divergence times of functional MC1R variants

  • Apply population genetics models to determine selection coefficients

  • Use Bayesian approaches to reconstruct trait evolution

  • Develop simulations of pigmentation pattern evolution

Table 2: Proposed Workflow for Evolutionary Analysis of MC1R Variants

This integrated approach allows researchers to connect molecular variations in MC1R to phenotypic traits and ecological adaptations across primate evolution, with particular focus on understanding the evolutionary significance of T. francoisi coloration patterns.

What are the emerging technologies that might advance our understanding of MC1R function in primates like Trachypithecus francoisi?

Several cutting-edge technologies are poised to transform MC1R research in primates:

Cryo-electron microscopy (Cryo-EM):

• High-resolution structural determination of MC1R in various activation states

• Visualization of ligand-binding dynamics without crystallization requirements

• Potential to resolve species-specific structural differences

CRISPR/Cas9 genome editing:

• Precise modification of MC1R in primate cell lines

• Creation of isogenic cell lines differing only in MC1R sequence

• Introduction of T. francoisi MC1R variants into model systems

Single-cell transcriptomics:

• Characterization of MC1R expression at single-cell resolution

• Identification of cell-specific signaling networks

• Mapping of melanocyte heterogeneity in different skin/fur regions

Organoid technologies:

• Development of skin organoids expressing T. francoisi MC1R

• Recapitulation of 3D tissue architecture for more physiological models

• Long-term studies of melanocyte development and pigmentation

Integrative multi-omics approaches:

• Combined genomic, proteomic, and metabolomic analysis

• Systems biology modeling of MC1R signaling networks

• Machine learning applications for predicting variant effects

These technologies, particularly when combined, offer unprecedented opportunities to understand the molecular basis of primate pigmentation patterns and the evolutionary significance of MC1R variations across species.

How might understanding Trachypithecus francoisi MC1R contribute to broader conservation genetics efforts?

Research on T. francoisi MC1R has significant implications for conservation genetics:

Conservation applications:

• Population genetics assessment:

  • MC1R variants can serve as neutral markers for population structure analysis

  • Assessment of genetic diversity within fragmented T. francoisi populations

  • Identification of locally adapted variants that may require conservation

• Hybridization monitoring:

  • Detection of hybridization between T. francoisi and closely related species

  • MC1R as a phenotypically relevant marker for monitoring genetic introgression

  • Development of diagnostic assays for field application

• Adaptive potential evaluation:

  • Understanding the adaptive significance of MC1R variants in changing environments

  • Predicting potential impacts of habitat shifts on protective coloration

  • Assessing evolutionary potential for adaptation to new selective pressures

• Ex-situ conservation planning:

  • Genotype-informed breeding programs to maintain genetic diversity

  • Preservation of locally adapted MC1R variants in captive populations

  • Genetic rescue strategies based on functional understanding of variants

By studying MC1R in T. francoisi, researchers can develop molecular tools that simultaneously inform evolutionary history and provide practical applications for conservation management of this vulnerable primate species.

What are the potential comparative insights from studying melanocortin receptor systems across different primate species?

Cross-species analysis of melanocortin receptors offers valuable evolutionary insights:

Comparative evolutionary perspectives:

• Adaptive radiation patterns:

  • Correlation between MC1R sequence divergence and species radiation events

  • Identification of convergent evolution in distantly related species

  • Mapping of selection pressures driving functional diversification

• Phenotypic diversity mechanisms:

  • Molecular basis for the extraordinary diversity of primate coat patterns

  • Regulatory versus coding sequence evolution in determining phenotypes

  • Pleiotropic effects of MC1R variants on other physiological systems

• Signaling pathway evolution:

  • Conservation and divergence of downstream effectors across primates

  • Evolution of ligand specificity and receptor sensitivity

  • Coevolution of MC1R with other pigmentation genes

• Ecological adaptation signatures:

  • UV radiation adaptation across different primate habitats

  • Camouflage evolution in relation to predator-prey dynamics

  • Social signaling functions of distinctive coat patterns

Table 3: Comparative Analysis of MC1R Function Across Primate Clades

This comparative framework provides a powerful approach for understanding the molecular basis of phenotypic diversity and the evolutionary processes shaping primate adaptation.