Recombinant Trachypithecus johnii C-C chemokine receptor type 5 (CCR5)

Shipped with Ice Packs
In Stock

Description

Biological Roles

  • Immune Function: Mediates chemotaxis of T cells, macrophages, and dendritic cells via CCL3, CCL4, and CCL5 ligands .

  • Viral Pathogenesis: Serves as a coreceptor for SIV/HIV entry in primates . Notably, Trachypithecus CCR5 retains Asp13, a residue critical for CD4-independent SIV gp120 binding in some primates .

  • Host Defense: Essential for NK cell trafficking during Toxoplasma gondii infection in murine models .

HIV/SIV Studies

  • Comparative analyses of primate CCR5 sequences reveal evolutionary adaptations influencing lentiviral resistance . For example:

    • Trachypithecus CCR5 shares 94% amino acid identity with human CCR5 but diverges in extracellular regions modulating ligand specificity .

    • Structural differences in ECL2 may explain reduced susceptibility to certain SIV strains .

Signaling Pathways

  • Activates Gαi-mediated pathways upon ligand binding, inhibiting cAMP production and mobilizing calcium .

  • Engages β-arrestin for receptor internalization and recycling .

Biochemical Properties

PropertyValue
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol recommended for long-term storage
Endotoxin Level<1.0 EU/μg (LAL test)
StabilityRetains >95% activity after 48h at 37°C

Functional Assays

  • Binding Affinity: Strong interaction with CCL5 (RANTES) and CCL3 (MIP-1α) .

  • HIV Inhibition: Competes with human CCR5 for viral gp120 binding in vitro .

Comparative Analysis With Other Primate CCR5

SpeciesKey DifferencesImplications
Homo sapiensLysine at position 26 (vs. arginine in Trachypithecus)Alters chemokine binding kinetics
Macaca mulattaAsp13 conserved across all primatesFacilitates CD4-independent SIV entry
Cercopithecus tantalusDivergent ECL3 residuesReduces HIV-1 fusion efficiency

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requirements for the format. Please specify your preference when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: Our proteins are shipped standard with normal blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
CCR5; CMKBR5; C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CD antigen CD195
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Trachypithecus johnii (Nilgiri langur) (Semnopithecus johnii)
Target Names
Target Protein Sequence
MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRSEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKHFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Uniprot No.

Target Background

Function
CCR5 serves as a receptor for several inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES. Upon binding, CCR5 transduces a signal by increasing intracellular calcium ion levels. This receptor may play a role in controlling granulocytic lineage proliferation or differentiation. CCR5 participates in T-lymphocyte migration to infection sites by acting as a chemotactic receptor.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Trachypithecus johnii CCR5 and what is its evolutionary relationship to human CCR5?

Within the Cercopithecidae family, nucleotide similarities in CCR5 range from 98.0-99.5%, indicating relatively low genetic diversity despite millions of years of evolutionary divergence . This conservation suggests strong selective pressure to maintain CCR5 function across primate evolution, likely due to its important role in immune system function. Nevertheless, subtle species-specific changes have accumulated, particularly in regions involved in ligand binding and receptor regulation.

What are the key structural features of primate CCR5 proteins and how does Trachypithecus johnii CCR5 compare?

Primate CCR5 proteins, including Trachypithecus johnii CCR5, belong to the seven-transmembrane G-protein-coupled receptor superfamily. Key structural features include:

  • An extracellular N-terminus containing sulfated tyrosines important for ligand binding and HIV/SIV entry

  • Seven transmembrane α-helical domains spanning the cell membrane

  • Three extracellular loops (ECLs) that contribute to ligand binding specificity

  • Three intracellular loops (ICLs) involved in G-protein coupling and signal transduction

  • An intracellular C-terminus containing phosphorylation sites for receptor regulation

Studies of other Cercopithecidae CCR5 proteins indicate that amino acid substitutions tend to cluster in specific regions: the amino and carboxy termini, the first transmembrane domain, and the second extracellular loop . Trachypithecus johnii CCR5 likely follows this pattern, with species-specific changes in these regions. Like other non-human primate CCR5 homologues from the suborder Anthropoidea, Trachypithecus johnii CCR5 presumably contains amino acid substitutions at positions 13 (N to D) and 129 (V to I) compared to human CCR5 . The position 13 change is particularly significant as it is critical for CD4-independent binding of SIV to CCR5, potentially affecting how the receptor interacts with lentiviruses .

What methods are most effective for cloning and expressing recombinant Trachypithecus johnii CCR5?

Based on approaches used for other primate CCR5 homologues, the following methods are effective for cloning and expressing recombinant Trachypithecus johnii CCR5:

  • PCR amplification of CCR5 DNA from Trachypithecus johnii peripheral blood mononuclear cells using primers flanking the coding region of the gene . This approach has been successfully used to amplify CCR5 from 24 different primate species and subspecies.

  • Insertion of the full-length CCR5 sequence into an expression vector such as pCDNA3.1, which has proven effective for primate CCR5 expression . Multiple clones should be sequenced to discriminate between alleles and confirm sequence accuracy.

  • Transfection of the expression vector into mammalian cell lines, such as HEK293T or HOS.CD4 cells, for functional expression. HOS.CD4 cells have been particularly useful for studying primate CCR5 homologues as co-receptors for HIV/SIV entry .

  • Verification of expression using techniques such as flow cytometry with CCR5-specific antibodies or cross-reactive antibodies against conserved CCR5 epitopes.

The choice of expression system should be guided by the specific research objectives, with mammalian cell lines being preferred for functional studies due to their ability to perform appropriate post-translational modifications, particularly tyrosine sulfation, which is critical for CCR5 function .

How does Trachypithecus johnii CCR5 function as a chemokine receptor?

Trachypithecus johnii CCR5, like other primate CCR5 homologues, functions as a receptor for CC chemokines, including CCL3 (MIP-1α), CCL4 (MIP-1β), and CCL5 (RANTES). The receptor-ligand interaction triggers various intracellular signaling pathways that mediate chemotaxis and immune cell activation. The functional mechanism involves:

  • Binding of chemokines to the extracellular domains of CCR5, particularly the N-terminus and extracellular loops

  • Conformational changes in the receptor transmembrane domains

  • Activation of G-proteins coupled to the intracellular domains of CCR5

  • Initiation of downstream signaling cascades, including calcium flux, MAP kinase activation, and cytoskeletal rearrangements

  • Receptor internalization and recycling or degradation

What are the optimal cell lines for expressing recombinant Trachypithecus johnii CCR5?

The optimal cell lines for expressing recombinant Trachypithecus johnii CCR5 depend on the specific research objectives:

  • HEK293T cells: These human embryonic kidney cells are widely used for transient and stable expression of G-protein-coupled receptors, including CCR5, due to their high transfection efficiency and robust protein expression.

  • HOS.CD4 cells: These human osteosarcoma cells expressing CD4 have been used successfully to express CCR5 homologues from various primate species for HIV/SIV entry studies . They provide a suitable background for assessing co-receptor function.

  • CHO cells: Chinese hamster ovary cells are commonly used for stable expression of recombinant proteins, including GPCRs, and may be advantageous for large-scale production.

  • Sf9/Sf21 insect cells: These cells, when used with the baculovirus expression system, can produce high yields of recombinant protein and may be useful for structural studies.

For functional studies of Trachypithecus johnii CCR5 as an HIV/SIV co-receptor, cell lines lacking endogenous expression of CD4 and CCR5 (such as HOS.CD4) are preferable to avoid interference from host receptors . For studies of chemokine binding and signaling, cell lines with low background G-protein activity may be advantageous to minimize signal-to-noise issues in functional assays.

How do amino acid differences in Trachypithecus johnii CCR5 affect its interaction with HIV-1 compared to human CCR5?

Amino acid differences in Trachypithecus johnii CCR5 likely affect its interaction with HIV-1 in several ways:

  • N-terminal domain differences: Studies of other primate CCR5 homologues indicate that Anthropoidea primates, including Cercopithecidae species like Trachypithecus johnii, typically have an N to D substitution at position 13 . This change is critical for CD4-independent binding of SIV to CCR5 but may affect HIV-1 interaction differently.

  • Extracellular loop changes: Amino acid substitutions in the second extracellular loop, which are common among primate CCR5 homologues , may alter the binding site for the V3 loop of the HIV-1 envelope glycoprotein.

  • Tyrosine sulfation differences: The sulfation of tyrosine residues in the N-terminus is important for HIV-1 entry. Research on owl monkey CCR5 has shown that human residues 15Y and 16T within a sulfation motif can enhance function for HIV-1 entry . The presence or absence of these residues in Trachypithecus johnii CCR5 would influence its interaction with HIV-1.

  • Receptor-CD4 cross-talk: The effectiveness of Trachypithecus johnii CCR5 as an HIV-1 co-receptor would depend on its ability to engage in cross-talk with CD4. Studies of owl monkey CCR5 revealed that this cross-talk involves the sulfation motif , and variations in this region could affect co-receptor function.

These species-specific differences could contribute to variations in susceptibility to different HIV-1 strains and might help explain the restricted host range of HIV-1 among primate species. Studies combining chimeric receptors and site-directed mutagenesis would be valuable for mapping the specific determinants of these functional differences.

What techniques can be used to assess the binding affinity of ligands to recombinant Trachypithecus johnii CCR5?

Several techniques can be employed to assess the binding affinity of ligands to recombinant Trachypithecus johnii CCR5:

  • Radioligand binding assays:

    • Saturation binding with radioactively labeled chemokines to determine Kd values

    • Competition binding assays to determine Ki values for unlabeled ligands

    • Kinetic binding assays to determine association and dissociation rates

  • Fluorescence-based techniques:

    • Fluorescence resonance energy transfer (FRET) between labeled ligands and receptors

    • Flow cytometry with fluorescently labeled chemokines or antibodies

    • Fluorescence polarization assays for high-throughput screening

  • Surface plasmon resonance (SPR):

    • Real-time analysis of binding kinetics using purified receptor immobilized on sensor chips

    • Determination of association and dissociation rate constants (kon and koff)

  • Microscale thermophoresis (MST):

    • Measurement of binding affinities based on changes in thermophoretic mobility

    • Requires minimal amounts of protein and can be performed in solution

  • Functional assays:

    • Calcium flux assays to measure receptor activation

    • β-arrestin recruitment assays

    • G-protein activation assays (e.g., GTPγS binding)

For comparative studies with human CCR5, parallel assays should be performed under identical conditions to accurately assess species-specific differences in binding properties. This approach allows for direct comparison of binding parameters and can help identify subtle differences in ligand recognition that may have functional consequences.

How does post-translational modification, particularly sulfation, affect Trachypithecus johnii CCR5 function?

Post-translational modifications, especially tyrosine sulfation, are crucial for CCR5 function:

  • Tyrosine sulfation in the N-terminus:

    • Human CCR5 has four tyrosine residues (Y3, Y10, Y14, and Y15) in the N-terminus that can be sulfated

    • Sulfation enhances binding of chemokines and HIV-1 envelope glycoprotein

    • Studies of owl monkey CCR5 have shown that human residues 15Y and 16T within a sulfation motif are important for HIV-1 entry function

    • Trachypithecus johnii CCR5 likely has species-specific patterns of tyrosine residues that affect sulfation and function

  • Methodological approaches to study sulfation effects:

    • Expression in cell lines with varying abilities to perform tyrosine sulfation

    • Treatment with sodium chlorate to inhibit sulfation

    • Site-directed mutagenesis of tyrosine residues

    • Mass spectrometry to identify sulfated residues

    • Functional assays comparing wild-type and sulfation-deficient receptor variants

  • Other post-translational modifications:

    • N-linked glycosylation may affect receptor folding and trafficking

    • Palmitoylation of cysteine residues in the C-terminus affects receptor signaling and internalization

    • Phosphorylation regulates receptor desensitization and internalization

The pattern and extent of these post-translational modifications in Trachypithecus johnii CCR5 could significantly influence its function as both a chemokine receptor and viral co-receptor. The sulfation motif, in particular, appears to be involved in cross-talk between CCR5 and CD4 during HIV-1 entry , suggesting that species-specific differences in this region could affect viral tropism.

What are the implications of Trachypithecus johnii CCR5 research for understanding species-specific barriers to lentiviral infection?

Research on Trachypithecus johnii CCR5 has several implications for understanding species-specific barriers to lentiviral infection:

  • Co-receptor compatibility:

    • Differences in CCR5 structure between primate species can create barriers to cross-species transmission of lentiviruses

    • Studying Trachypithecus johnii CCR5 function as a co-receptor for various HIV and SIV strains can help map the molecular determinants of host range

  • Evolutionary insights:

    • Comparing CCR5 sequences across primates, including Trachypithecus johnii, can reveal patterns of positive selection that reflect historical exposures to lentiviruses

    • These patterns may identify specific amino acid positions critical for virus-host interactions

  • Receptor-virus adaptation:

    • Understanding how specific changes in Trachypithecus johnii CCR5 affect interaction with different viral strains can illuminate co-evolutionary dynamics

    • This knowledge can inform predictions about potential zoonotic transmission risks

  • Receptor-CD4 interactions:

    • Research on owl monkeys has shown that both CD4 and CCR5 receptors influence virus entry, with cross-talk between these receptors involving the sulfation motif

    • Studying whether similar dynamics apply to Trachypithecus johnii receptors would provide insights into the complexity of species barriers

The findings from such research could contribute to broader understanding of how viruses adapt to new hosts and the molecular determinants that facilitate or prevent cross-species transmission. This knowledge has implications for predicting and potentially preventing future zoonotic events.

How can CRISPR-Cas9 be used to modify Trachypithecus johnii CCR5 for functional studies?

CRISPR-Cas9 technology offers several approaches for modifying Trachypithecus johnii CCR5 for functional studies:

  • Knockout studies:

    • Complete elimination of CCR5 expression in Trachypithecus johnii cells to study its role in immune function

    • CRISPR-mediated disruption of the CCR5 gene followed by functional assays to assess phenotypic consequences

  • Knock-in modifications:

    • Introduction of specific mutations corresponding to known functional variants (e.g., human CCR5Δ32 equivalent)

    • Creation of reporter-tagged CCR5 for live-cell imaging studies

    • Introduction of human-specific amino acids to study their effect on receptor function

  • Domain swapping:

    • CRISPR-mediated homology-directed repair to replace specific domains (e.g., N-terminus, extracellular loops) with corresponding human domains

    • Generation of chimeric receptors to map functional determinants

  • Regulatory studies:

    • Modification of CCR5 promoter elements to study transcriptional regulation

    • Integration of inducible expression systems

Research has shown that CRISPR-based approaches to CCR5 modification have gained interest for HIV studies due to their efficacy and reduced off-target effects compared to other gene editing techniques . Similar approaches could be adapted for Trachypithecus johnii CCR5 studies, providing powerful tools for dissecting the relationship between receptor structure and function.

What are the optimal conditions for solubilizing and purifying recombinant Trachypithecus johnii CCR5?

Solubilizing and purifying recombinant Trachypithecus johnii CCR5, like other membrane proteins, requires careful optimization of conditions:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO) for native-like post-translational modifications

    • Insect cell systems (Sf9, Sf21) for higher yield

    • Consideration of fusion tags (e.g., GFP, MBP) to enhance solubility and aid purification

  • Membrane preparation:

    • Gentle lysis methods to preserve protein structure

    • Differential centrifugation to isolate membrane fractions

    • Careful handling to minimize denaturation

  • Solubilization strategies:

    • Detergent screening (e.g., DDM, LMNG, MNG-3) to identify optimal solubilization conditions

    • Mixed detergent-lipid systems for enhanced stability

    • Cholesterol supplementation to maintain receptor conformation

    • pH and ionic strength optimization

  • Purification approach:

    • Affinity chromatography using tags (His, FLAG, etc.) or ligand-based matrices

    • Size-exclusion chromatography to remove aggregates and verify monodispersity

    • Ion-exchange chromatography for additional purification if needed

  • Stability assessment:

    • Thermal shift assays to optimize buffer conditions

    • Ligand addition to enhance stability during purification

    • Conformational antibodies to verify native-like structure

The optimal conditions would need to be determined empirically, starting with approaches that have been successful for other CCR5 homologues and adapting them to the specific properties of Trachypithecus johnii CCR5.

How can researchers develop antibodies specific to Trachypithecus johnii CCR5?

Developing antibodies specific to Trachypithecus johnii CCR5 requires strategic approaches:

  • Antigen design and preparation:

    • Synthetic peptides corresponding to species-specific regions (e.g., N-terminus, extracellular loops)

    • Recombinant protein fragments expressed in E. coli or yeast

    • Full-length receptor in nanodiscs or liposomes for conformational epitopes

    • DNA immunization with expression vectors encoding Trachypithecus johnii CCR5

  • Immunization strategies:

    • Selection of appropriate species (rabbit, mouse, chicken) distant from primates

    • Prime-boost protocols to enhance immune response

    • Adjuvant selection to optimize antibody production

    • Monitoring of immune response via ELISA or flow cytometry

  • Screening and selection methods:

    • ELISA against peptides or recombinant fragments

    • Flow cytometry with cells expressing Trachypithecus johnii CCR5

    • Cross-reactivity testing against human and other primate CCR5 homologues

    • Functional assays to identify antibodies that block or modulate receptor function

  • Monoclonal antibody development:

    • Hybridoma generation and screening

    • Phage display library construction and selection

    • Single B-cell cloning from immunized animals

When developing antibodies, researchers should target regions of Trachypithecus johnii CCR5 that differ from human and other primate CCR5 homologues to ensure specificity, while considering the conservation of critical functional epitopes if neutralizing antibodies are desired.

What reporter systems are most effective for studying Trachypithecus johnii CCR5 signaling pathways?

Several reporter systems can be used to study Trachypithecus johnii CCR5 signaling pathways:

  • Calcium mobilization assays:

    • Fluorescent calcium indicators (Fluo-4, Fura-2) to measure intracellular calcium release upon receptor activation

    • FLIPR (Fluorometric Imaging Plate Reader) for high-throughput screening

    • Aequorin-based bioluminescent calcium detection systems

  • cAMP signaling reporters:

    • BRET or FRET-based sensors for real-time monitoring of cAMP levels

    • GloSensor technology for luminescence-based detection

    • CRE-luciferase reporter constructs for transcriptional readout

  • β-arrestin recruitment assays:

    • BRET between receptor-Rluc and β-arrestin-YFP fusions

    • Enzyme complementation assays (e.g., PathHunter)

    • Translocation of fluorescently tagged β-arrestin

  • G-protein activation assays:

    • BRET-based sensors for direct monitoring of G-protein conformational changes

    • [35S]GTPγS binding assays for biochemical measurement

    • Dissociation of fluorescently labeled Gα and Gβγ subunits

  • Downstream signaling pathway reporters:

    • MAPK pathway activation (e.g., ERK phosphorylation)

    • Transcription factor reporters (e.g., NFAT, NF-κB, SRE)

    • Cytoskeletal rearrangement detection systems

The choice of reporter system should be guided by the specific signaling pathway of interest and the temporal resolution required. Validation with multiple orthogonal approaches is recommended to confirm findings.

How can molecular dynamics simulations contribute to understanding Trachypithecus johnii CCR5 structure-function relationships?

Molecular dynamics (MD) simulations offer powerful approaches to understanding Trachypithecus johnii CCR5 structure-function relationships:

  • Structural prediction and refinement:

    • Homology modeling based on human CCR5 crystal structures

    • Refinement of models through MD simulations in membrane environments

    • Integration of experimental constraints from mutagenesis or spectroscopy data

  • Dynamic behavior analysis:

    • Identification of conformational states (active, inactive, intermediate)

    • Characterization of flexibility in key functional regions

    • Analysis of allosteric communication networks within the receptor

  • Ligand-receptor interactions:

    • Binding mode predictions for chemokines and small molecules

    • Free energy calculations to estimate binding affinities

    • Identification of species-specific interaction determinants

  • Species-specific feature analysis:

    • Comparative simulations of human and Trachypithecus johnii CCR5

    • Investigation of how amino acid differences alter structural dynamics

    • Prediction of functional consequences of species-specific variations

  • Post-translational modification effects:

    • Simulation of sulfated and non-sulfated receptor variants

    • Analysis of how glycosylation affects receptor dynamics

    • Investigation of phosphorylation effects on C-terminal interactions

  • Receptor-CD4 interactions:

    • Modeling of receptor complexes to understand co-receptor function

    • Investigation of cross-talk mechanisms suggested by experimental data

    • Prediction of species-specific differences in complex formation

MD simulations can generate testable hypotheses about structure-function relationships that can guide experimental design and help interpret experimental results, particularly in comparative studies between human and Trachypithecus johnii CCR5.

What are the best approaches for studying Trachypithecus johnii CCR5 expression patterns in different tissues?

Several complementary approaches can be used to study Trachypithecus johnii CCR5 expression patterns:

  • Transcriptomic analysis:

    • RNA-Seq of different tissues to quantify CCR5 mRNA expression

    • Single-cell RNA-Seq to identify specific cell populations expressing CCR5

    • Comparative analysis with human expression patterns

    • qRT-PCR validation of expression in specific tissues

  • Protein detection methods:

    • Immunohistochemistry using specific or cross-reactive antibodies

    • Western blotting for semi-quantitative analysis

    • Flow cytometry for quantitative analysis in cell suspensions

    • Mass spectrometry-based proteomics for unbiased detection

  • In situ techniques:

    • RNAscope for high-sensitivity mRNA detection in tissue sections

    • Fluorescence in situ hybridization (FISH) for cellular localization

    • Multiplexed immunofluorescence for co-expression analysis

    • Spatial transcriptomics for comprehensive tissue mapping

  • Reporter systems:

    • BAC transgenic approaches with fluorescent reporters under CCR5 regulatory elements

    • Luciferase reporters for quantitative analysis of promoter activity

    • CRISPR knock-in of reporter tags for endogenous expression tracking

Based on studies of CCR5 expression in humans and other species, particular attention should be paid to immune cells (T cells, macrophages, dendritic cells), as well as cells of the nervous system, given the emerging evidence for CCR5's role beyond the immune system . CCR5 expression is known to correlate strongly with CD8 T-cell levels, as demonstrated in COVID-19 studies , suggesting this relationship may be conserved across primate species.

How does Trachypithecus johnii CCR5 compare to CCR5 in other Cercopithecidae species in terms of sequence and function?

Comparative analysis of Trachypithecus johnii CCR5 with other Cercopithecidae species provides important insights into structure-function relationships:

  • Sequence comparison:

    • Cercopithecidae CCR5 sequences generally share 96-99% amino acid homology with human CCR5

    • Within the Cercopithecidae family, nucleotide similarities range from 98.0-99.5%

    • Species-specific changes tend to cluster in the amino and carboxy termini, first transmembrane domain, and second extracellular loop

    • Trachypithecus johnii CCR5 likely contains the N13D and V129I substitutions common to Anthropoidea primates

  • Functional implications:

    • The N13D substitution is critical for CD4-independent binding of SIV to CCR5

    • Species-specific patterns in the N-terminus may affect chemokine binding specificity

    • Variations in the second extracellular loop can influence HIV/SIV co-receptor function

    • Differences in the C-terminus may affect receptor trafficking and desensitization

Table 1: Comparison of key amino acid positions in CCR5 across primate species

PositionHumanTypical CercopithecidaeFunctional Significance
13NDCD4-independent binding of SIV
129VITransmembrane domain structure
15-16YTVariableTyrosine sulfation motif
2nd ECLVariableSpecies-specificHIV/SIV V3 loop interaction

Despite the high sequence similarity, even minor amino acid differences can significantly impact receptor function, as demonstrated by studies of owl monkey CCR5 where specific residues in the sulfation motif affected function .

What can comparative studies of Trachypithecus johnii CCR5 and human CCR5 tell us about primate evolution?

Comparative studies of Trachypithecus johnii CCR5 and human CCR5 provide valuable insights into primate evolution:

  • Molecular evolution patterns:

    • Analysis of substitution rates can identify regions under different selection pressures

    • Comparison of non-synonymous to synonymous substitution ratios (dN/dS) can reveal adaptive evolution

    • Identification of convergent evolution in different primate lineages

  • Host-pathogen co-evolution:

    • Evidence of selection driven by historical lentivirus exposure

    • Comparison with other immune genes to identify coordinated evolutionary patterns

    • Insights into the antiquity of primate lentivirus interactions

  • Functional constraint analysis:

    • Identification of highly conserved regions critical for basic chemokine receptor function

    • Recognition of variable regions that may reflect species-specific adaptations

    • Understanding of the balance between maintaining core function and adapting to selective pressures

  • Phylogenetic relationships:

    • CCR5 sequence data can contribute to resolving primate phylogenetic relationships

    • The phylogeny of primate CCR5 generally agrees with established systematics

    • Discrepancies may reveal interesting evolutionary events such as incomplete lineage sorting

Studies of CCR5 across primates have already contributed to our understanding of primate evolution, with patterns of sequence diversity generally consistent with established taxonomic relationships despite some intermingling of species from the Cebidae and Cercopithecidae families .

How do ligand binding properties differ between Trachypithecus johnii CCR5 and CCR5 from other primate species?

Differences in ligand binding properties between Trachypithecus johnii CCR5 and other primate CCR5 homologues:

  • Chemokine binding:

    • Species-specific variations in the N-terminus and extracellular loops affect chemokine binding affinity

    • Differences in tyrosine sulfation patterns influence interaction with chemokines

    • Binding kinetics (association and dissociation rates) may vary between species

    • Potential variations in chemokine selectivity profiles

  • HIV/SIV envelope glycoprotein binding:

    • The N13D substitution common in Anthropoidea primates affects CD4-independent binding of SIV

    • Species-specific variations in the second extracellular loop affect interaction with the V3 loop of HIV/SIV envelope

    • Differences in co-receptor efficiency for different viral strains

  • Small molecule antagonist binding:

    • Variations in the transmembrane domains may affect binding pocket architecture

    • Species-specific differences in antagonist potency and selectivity

    • Potential differences in allosteric modulation mechanisms

Experimental design for such studies should include parallel testing of multiple primate CCR5 homologues under identical conditions to facilitate direct comparison of binding parameters. This approach can reveal subtle species-specific variations in receptor pharmacology that may have implications for drug development and understanding viral tropism.

What are the differences in signaling pathways activated by Trachypithecus johnii CCR5 compared to human CCR5?

Potential differences in signaling pathways activated by Trachypithecus johnii CCR5 compared to human CCR5:

  • G-protein coupling specificity:

    • Variations in the intracellular loops and C-terminus may affect G-protein subtype preference

    • Differences in coupling efficiency to Gαi, Gαq, or other G-protein subtypes

    • Species-specific patterns of G-protein-independent signaling

  • β-arrestin recruitment and signaling:

    • Variations in phosphorylation sites may affect β-arrestin binding

    • Differences in the balance between G-protein and β-arrestin signaling (biased signaling)

    • Species-specific patterns of receptor internalization and recycling

  • Downstream pathway activation:

    • Variations in calcium mobilization dynamics

    • Differences in MAPK pathway activation kinetics and magnitude

    • Species-specific effects on transcriptional regulation

  • Receptor regulation:

    • Differences in desensitization and resensitization kinetics

    • Variations in receptor half-life and degradation pathways

    • Species-specific patterns of receptor cross-talk with other signaling systems

While core signaling mechanisms are likely conserved, even subtle differences in signaling kinetics or pathway preferences could contribute to species-specific immune responses and susceptibility to infectious diseases. These differences could be particularly relevant when studying the broader biological roles of CCR5 beyond immune function, such as its potential involvement in neurological processes .

How can heterologous expression systems be used to compare functional properties of Trachypithecus johnii CCR5 with other primate CCR5 homologues?

Heterologous expression systems offer powerful tools for comparative functional analysis of CCR5 homologues:

  • Cell line selection considerations:

    • Use of null backgrounds lacking endogenous CCR5 (e.g., HEK293 or CHO cells)

    • Consistent expression levels across compared receptors

    • Assessment in both immune and non-immune cell backgrounds

    • Co-expression with relevant signaling components

  • Expression strategies:

    • Stable cell lines for consistent expression levels

    • Inducible expression systems for controlled expression timing

    • Bicistronic vectors with fluorescent markers for expression monitoring

    • Viral transduction for difficult-to-transfect cells

  • Comparative functional assays:

    • Ligand binding studies with identical radioligand concentrations

    • Calcium mobilization using standardized protocols

    • MAPK activation kinetics comparison

    • Migration assays in identical chemokine gradients

    • Viral entry assays with standardized viral inputs

  • Chimeric receptor approaches:

    • Domain-swapping experiments to map functional differences to specific receptor regions

    • Progressive introduction of human residues into Trachypithecus johnii CCR5 to identify critical differences

    • Mutagenesis of specific amino acids identified through sequence comparison

Studies with owl monkey CCR5 have demonstrated the value of such approaches, revealing that both owl monkey CD4 and CCR5 receptors are functional for HIV-1 entry when paired with human versions of the other receptor, but the owl monkey CD4/CCR5 pair is generally suboptimal . Similar studies with Trachypithecus johnii receptors could provide insights into species-specific aspects of receptor function and viral tropism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.