Recombinant Trachypithecus obscurus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please specify your needs in the order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Trachypithecus obscurus (Dusky leaf-monkey) (Presbytis obscura)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV VAIARNRNLHSPMYCFICCLALSDLLVSGSNMLETAVFLLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLRRARRVVAAIWVASVLFSTLFI AYCDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGVGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKKVLLCSW
Uniprot No.

Target Background

Function
This protein serves as a receptor for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. This receptor regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by controlling cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Melanocyte-stimulating hormone receptor (MC1R) in Trachypithecus obscurus?

The Melanocyte-stimulating hormone receptor (MC1R) in Trachypithecus obscurus (also known as Dusky leaf-monkey or Presbytis obscura) is a G-protein coupled receptor involved in pigmentation regulation. It is a full-length protein comprising 317 amino acids with UniProt accession number Q864I5 . MC1R belongs to the G-protein coupled receptor 1 family, similar to its homologs in other species, and functions as a receptor for melanocyte-stimulating hormones (MSH). In primates, as in other vertebrates, this receptor plays a crucial role in regulating the production of melanin pigments, influencing coat color and skin pigmentation characteristics .

Trachypithecus obscurus is a primate species that inhabits tropical rainforests in Peninsular Malaysia, Thailand, and Myanmar, with at least five morphologically described subspecies distributed throughout these regions . The study of MC1R in this species provides valuable insights into primate evolution and adaptive pigmentation mechanisms.

How does the structure and function of MC1R compare between Trachypithecus obscurus and humans?

The MC1R protein shows considerable conservation between Trachypithecus obscurus and humans, reflecting its evolutionary importance in vertebrate pigmentation. The human MC1R is also 317 amino acids in length and functions similarly as a receptor for MSH (alpha, beta, and gamma) and ACTH . In humans, MC1R activity is mediated by G proteins that activate adenylate cyclase, leading to increased cAMP production which ultimately regulates melanogenesis .

Sequence comparison reveals high conservation in functional domains, particularly in the transmembrane regions and ligand-binding sites. The comparative amino acid sequences show:

SpeciesSequence Excerpt (Representative Region)Key Functional Domains
T. obscurusMPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVVVAIARNRNLHSPMYCFICCLALSDLLVSGSN...Transmembrane domains, G-protein binding sites, ligand-binding pocket
HumanMAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVVATIAKNRNLHSPMYCFICCLALSDLLVSGSN...Transmembrane domains, G-protein binding sites, ligand-binding pocket

Both proteins function through similar molecular mechanisms, with activity mediated by G proteins that activate adenylate cyclase . The patterns of amino acid substitution across different regions of the receptor are similar to patterns seen in mammals, suggesting comparable levels of constraint and a conserved function for MC1R across primate species .

What are the optimal storage and handling conditions for recombinant Trachypithecus obscurus MC1R?

For optimal maintenance of recombinant Trachypithecus obscurus MC1R protein stability and activity, the following storage and handling conditions are recommended:

  • Storage buffer: Tris-based buffer containing 50% glycerol, specifically optimized for this protein

  • Long-term storage: -20°C or -80°C for extended preservation

  • Working aliquots: Store at 4°C for up to one week

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it may lead to protein degradation and loss of activity

When working with the recombinant protein, it is advisable to aliquot the stock solution into smaller volumes upon first thawing to minimize freeze-thaw cycles. The presence of 50% glycerol in the storage buffer helps prevent freeze-thaw damage and maintains protein stability. For experimental applications, it is recommended to dilute the protein in an appropriate buffer immediately before use.

What experimental methods are commonly used to study MC1R expression and activity?

Several methodological approaches are employed to study MC1R expression and activity in research settings:

  • Protein Expression Analysis:

    • Quantitative immunofluorescence: Allows precise measurement of MC1R expression levels not discernible by standard immunohistochemistry

    • Immunohistochemistry (IHC): Used to detect MC1R protein in tissue sections

    • Western blotting (WB): For quantification of MC1R protein levels in cell or tissue lysates

  • Functional Assays:

    • cAMP accumulation assays: Measures MC1R-mediated activation of adenylate cyclase

    • Melanin content assays: Quantifies the melanin production in melanocytes following MC1R activation

    • Calcium flux assays: Monitors intracellular calcium mobilization upon receptor activation

  • Genetic Analysis:

    • DNA sequencing of the MC1R locus: Identifies polymorphisms and mutations

    • Linkage disequilibrium analysis: Assesses evidence of selection on MC1R alleles

    • Silent-site heterozygosity measurement: Evaluates mutation rates and effective population size

  • Recombinant Protein Applications:

    • ELISA: For detection of MC1R protein and investigation of ligand-receptor interactions

    • Ligand binding assays: Measures binding affinity of natural and synthetic ligands

These methods can be applied to investigate MC1R in Trachypithecus obscurus tissue samples, cell cultures, or using recombinant proteins to understand the receptor's role in pigmentation and other physiological processes.

How can MC1R polymorphisms inform our understanding of primate adaptation and evolution?

MC1R polymorphisms provide valuable insights into primate adaptation and evolution, particularly regarding pigmentation phenotypes and their ecological significance:

  • Adaptive Color Variation:
    Studies of MC1R across vertebrates have shown that this gene plays a crucial role in adaptive color variation. In reptiles, for example, MC1R polymorphisms are strongly associated with color differences that relate to adaptation to different colored substrates or thermal environments . Similar principles may apply to primate evolution, where coat color could be adaptive for camouflage, thermoregulation, or social signaling.

  • Molecular Signatures of Selection:
    Analysis of MC1R sequences can reveal signatures of natural selection. Patterns observed in some species include:

    • Distribution of allele frequencies deviating from neutral expectations

    • Patterns of linkage disequilibrium consistent with recent selection

    • Higher rates of non-synonymous to synonymous substitutions in specific domains

  • Population Structure and Speciation:
    In Trachypithecus obscurus, molecular data has been used to differentiate subspecies that are morphologically similar . MC1R polymorphisms, when combined with other genetic markers, can help reconstruct population histories and processes of subspeciation in primates.

  • Comparative Evolutionary Rates:
    High levels of silent-site heterozygosity have been observed in MC1R across various species, consistent with a high mutation rate or large long-term effective population size . Comparing these patterns in Trachypithecus obscurus with other primates can provide insights into evolutionary dynamics.

The study of MC1R polymorphisms in Trachypithecus obscurus populations could therefore illuminate how different selective pressures have shaped coat color evolution in relation to their forest habitat requirements across their range in Southeast Asia.

What are the potential applications of Trachypithecus obscurus MC1R research in melanoma studies?

Research on Trachypithecus obscurus MC1R has potential translational applications in melanoma studies through several avenues:

  • Comparative Receptor Function and Signaling:
    Understanding the structural and functional differences between human and non-human primate MC1R can provide insights into the evolution of melanoma susceptibility. MC1R plays a critical role in human pigmentation and DNA repair mechanisms, with its expression levels showing a stepwise elevation during melanoma progression from benign nevi to metastatic melanoma . Comparative studies could identify conserved domains critical for these functions.

  • Development of MC1R-Targeted Therapies:
    MC1R-targeting agents are being investigated in clinical trials for melanoma patients . Recombinant Trachypithecus obscurus MC1R could serve as a model system for testing the specificity and cross-reactivity of these agents:

    • Alpha-particle emitting therapies targeting MC1R have shown promise in preclinical studies, with [225Ac]Ac-DOTA-MC1RL demonstrating prolonged survival and tumor growth delay in uveal melanoma xenografts

    • These therapies can remodel the tumor microenvironment and increase the fractions of immune cells, suggesting potential combination with immunotherapy

  • MC1R-Based Immunotherapy Development:
    MC1R-derived peptides can induce responses from cytotoxic T lymphocytes and tumor infiltrating lymphocytes, suggesting potential for MC1R-targeted melanoma therapeutic vaccines . Comparative analysis of primate MC1R epitopes could help identify highly conserved regions most likely to be effective targets.

  • Biomarker Development:
    The correlation between MC1R expression and melanoma progression suggests its potential as a prognostic biomarker. Higher MC1R expression is seen in deeper primary lesions (>1 mm), ulcerated lesions, and mucosal melanomas compared to cutaneous melanomas, and is associated with shorter survival in primary and metastatic tumors . Comparative studies could help validate these findings across species.

How can advanced imaging techniques be applied to study MC1R distribution in primate tissue samples?

Advanced imaging techniques offer powerful approaches to investigate MC1R distribution in primate tissue samples:

  • Quantitative Immunofluorescence:
    This technique allows precise measurement of MC1R expression levels in a fashion not discernible by standard immunohistochemistry . The methodology involves:

    • Tissue microarray construction for high-throughput analysis

    • Fluorophore-conjugated antibodies targeting MC1R

    • Digital image acquisition and quantitative analysis

    • Normalization to control proteins for comparative analysis

  • Multiplex Immunofluorescence:
    This approach enables simultaneous visualization of MC1R with other proteins of interest to study:

    • Co-localization with melanocyte markers

    • Association with signaling pathway components

    • Relationship to cell proliferation or apoptosis markers

    • Distribution relative to tissue microenvironment components

  • Confocal Microscopy:
    Provides high-resolution three-dimensional imaging of MC1R distribution:

    • Z-stack imaging to reconstruct 3D protein distribution

    • Co-localization analysis with subcellular markers

    • Live-cell imaging of recombinant fluorescent-tagged MC1R

  • Advanced Analytical Approaches:

    • Tissue cytometry: Combines flow cytometry principles with tissue imaging

    • Spatial transcriptomics: Correlates MC1R protein expression with local gene expression profiles

    • Image analysis algorithms: Quantifies expression patterns across different tissue regions

These methods can be applied to comparative studies between human and non-human primate tissue samples to better understand the evolutionary conservation of MC1R distribution and its relationship to pigmentation patterns and melanoma susceptibility.

What experimental design considerations are crucial when studying MC1R signaling pathways in primate cells?

When investigating MC1R signaling pathways in primate cells, researchers should consider the following experimental design factors:

  • Cell System Selection:

    • Primary melanocytes vs. established cell lines: Primary cells better represent physiological conditions but are challenging to maintain

    • Immortalized melanocyte lines: More stable but may have altered signaling pathways

    • Heterologous expression systems: Allow controlled expression but lack the natural cellular context

    • Comparative approach using both Trachypithecus obscurus and human cells: Enables evolutionary insights

  • Receptor Expression Considerations:

    • Endogenous vs. recombinant expression: Endogenous provides physiological relevance, while recombinant allows controlled experiments

    • Expression level verification: Western blotting, flow cytometry, or quantitative immunofluorescence

    • Potential for receptor polymorphisms: Sequencing verification of the MC1R gene in the cell system

  • Signaling Pathway Analysis:

    • cAMP measurement: Primary second messenger activated by MC1R

    • Downstream effector phosphorylation: PKA, CREB, and MITF activation

    • Temporal resolution: Both immediate and delayed signaling events

    • Dose-response relationships: Full range of ligand concentrations

    • Cross-talk with other pathways: Interactions with other melanocyte signaling systems

  • Experimental Controls:

    • Positive controls: Known MC1R agonists (α-MSH, β-MSH, γ-MSH, ACTH)

    • Negative controls: Unrelated peptides or vehicle

    • System validation: Forskolin to directly activate adenylyl cyclase

    • Antagonist studies: Agouti signaling protein (ASIP) or synthetic antagonists

  • Functional Outcomes Assessment:

    • Melanin production assays: Quantification of eumelanin and pheomelanin levels

    • Gene expression analysis: Melanogenic enzymes and regulatory factors

    • Cellular morphology and dendricity: Melanocyte differentiation markers

    • DNA repair capacity: UV challenge and damage quantification

A well-designed experimental approach should incorporate multiple complementary methods to comprehensively characterize MC1R signaling, ideally comparing results across different primate species to identify conserved and divergent aspects of the signaling pathway.

How does MC1R sequence conservation compare across primate species?

The conservation of MC1R sequences across primate species provides valuable insights into the evolutionary pressures acting on pigmentation genes:

  • Sequence Conservation Patterns:
    Comparison of MC1R sequences between Trachypithecus obscurus and other primates reveals high conservation in functional domains, particularly in:

    • Transmembrane domains

    • Ligand-binding regions

    • G-protein coupling sites

    • Intracellular signaling domains

    The patterns of amino acid substitution across different regions of the receptor are similar to patterns seen in mammals, suggesting comparable levels of constraint and probably a conserved function for MC1R across primates .

  • Comparative Sequence Analysis:
    When comparing the amino acid sequences of MC1R across primates, we observe:

    SpeciesSequence Identity with Human MC1RKey Differences
    Trachypithecus obscurus~90%Variations primarily in N-terminal region and third intracellular loop
    Pan troglodytes (Chimpanzee)~99%Few substitutions, mostly in non-functional regions
    Macaca mulatta (Rhesus macaque)~95%Variations in extracellular domains
  • Evolutionary Rate Analysis:
    High levels of silent-site heterozygosity have been observed in MC1R across various species, consistent with a high mutation rate or large long-term effective population size . This pattern extends to primate MC1R genes, though with variations that may reflect different selective pressures.

  • Functional Domain Conservation:
    The most highly conserved regions across primates correspond to functional domains essential for:

    • MSH binding

    • G-protein coupling

    • Receptor activation

    • Signal transduction

    These patterns of conservation highlight the fundamental importance of MC1R function in primate biology and suggest potential constraints on evolutionary divergence.

What methodological approaches can be used to study MC1R's role in primate coat color evolution?

Investigating MC1R's role in primate coat color evolution requires a multidisciplinary approach combining molecular genetics, comparative biology, and evolutionary analysis:

  • Comparative Sequence Analysis:

    • Complete MC1R sequencing across diverse primate species with varying coat colors

    • Identification of polymorphisms associated with color phenotypes

    • Phylogenetic analysis to map color changes onto primate evolutionary trees

    • Tests for selection (dN/dS ratios, McDonald-Kreitman tests) to identify adaptive evolution

  • Phenotype-Genotype Association Studies:

    • Sampling across subspecies with different coat colors (e.g., the five morphological subspecies of Trachypithecus obscurus in Peninsular Malaysia)

    • Statistical association between MC1R variants and quantitative measures of coat color

    • Control for population structure using neutral genetic markers

    • Analysis of linkage disequilibrium patterns to detect recent selection

  • Functional Characterization of MC1R Variants:

    • Heterologous expression of primate MC1R variants in cell culture systems

    • Measurement of cAMP production in response to MSH stimulation

    • Quantification of eumelanin vs. pheomelanin production

    • Site-directed mutagenesis to test specific amino acid contributions to function

  • Ecological Correlation Studies:

    • Mapping MC1R variation against habitat types, predation pressure, and climate variables

    • Testing hypotheses about adaptive significance of coat color variation

    • Comparative analysis of selection patterns across different primate lineages

    • Integration with data on other pigmentation genes (ASIP, TYR, TYRP1, etc.)

  • Ancient DNA and Museum Specimen Analysis:

    • Recovery of MC1R sequences from historical specimens

    • Reconstruction of temporal changes in allele frequencies

    • Correlation with historical habitat changes or selection pressures

These approaches, when integrated, can provide a comprehensive understanding of how MC1R variation has contributed to the evolution of coat color diversity across primates, with particular relevance to understanding subspeciation in Trachypithecus obscurus.

What are the optimal protocols for producing functionally active recombinant Trachypithecus obscurus MC1R?

Producing functionally active recombinant Trachypithecus obscurus MC1R requires careful consideration of expression systems and purification methods:

  • Expression System Selection:
    Several expression systems can be used, each with advantages and limitations:

    Expression SystemAdvantagesLimitationsApplications
    E. coliLow cost, high yield, rapid expressionLimited post-translational modifications, inclusion body formationStructural studies, antibody production
    Insect cellsBetter folding of GPCRs, some post-translational modificationsModerate cost, slower productionFunctional studies, binding assays
    Mammalian cellsFull post-translational modifications, natural foldingHigher cost, lower yieldSignaling studies, drug screening
    Wheat germ extractCell-free system, avoids toxicity issuesModerate yield, specialized equipment neededRapid prototyping, toxic proteins
  • Optimized Protocol Components:

    • Codon optimization for the selected expression system

    • Addition of appropriate affinity tags (His, FLAG, etc.) for purification

    • Signal peptide optimization for membrane targeting

    • Inclusion of stabilizing mutations if needed for structural integrity

    • Expression temperature and induction conditions optimization

  • Solubilization and Purification Strategy:

    • Careful membrane solubilization using mild detergents (DDM, LMNG)

    • Affinity chromatography using metal chelation or antibody-based methods

    • Size exclusion chromatography for final purification

    • Quality control by SDS-PAGE, Western blotting, and mass spectrometry

  • Functional Validation Methods:

    • Ligand binding assays using radiolabeled or fluorescent MSH derivatives

    • Reconstitution into lipid nanodiscs or proteoliposomes

    • G-protein coupling assays

    • cAMP accumulation measurements in reconstituted systems

  • Storage Conditions:
    For optimal stability, the purified recombinant protein should be stored in Tris-based buffer with 50% glycerol at -20°C for routine use or -80°C for long-term storage . Working aliquots can be maintained at 4°C for up to one week .

These methodological considerations are essential for producing recombinant Trachypithecus obscurus MC1R that retains its native structure and function for downstream applications in evolutionary, structural, and pharmacological studies.

What ELISA-based approaches are most effective for studying Trachypithecus obscurus MC1R?

ELISA-based approaches offer versatile tools for studying Trachypithecus obscurus MC1R in research settings:

  • Direct Detection ELISA:

    • Utilizes specific anti-MC1R antibodies to detect and quantify the receptor

    • Can be used with recombinant protein or tissue/cell lysates

    • Typically employs a sandwich format with capture and detection antibodies

    • Allows quantification in the range of 50-100 pg/ml with optimized protocols

  • Competitive Binding ELISA:

    • Measures the interaction between MC1R and its ligands (MSH variants, ACTH)

    • Uses labeled and unlabeled ligands competing for receptor binding

    • Enables determination of binding affinities and kinetics

    • Can detect species-specific differences in ligand recognition

  • Phospho-ELISA for Signaling:

    • Measures downstream phosphorylation events following MC1R activation

    • Targets phosphorylated CREB or other signaling intermediates

    • Provides quantitative measure of receptor functionality

    • Allows comparison of signaling efficiency between variants

  • Optimized Protocol Components:

    • Coating: Recombinant Trachypithecus obscurus MC1R at 1-10 μg/ml

    • Blocking: 1-5% BSA or casein to minimize background

    • Primary antibody: Species-specific anti-MC1R or cross-reactive antibodies

    • Detection: HRP-conjugated secondary antibody with TMB or other substrates

    • Controls: Recombinant human MC1R as comparative standard

  • Applications in Comparative Studies:

    • Quantitative comparison of MC1R expression across primate species

    • Evaluation of antibody cross-reactivity between human and non-human primate MC1R

    • Assessment of evolutionary conservation of epitopes

    • Screening of potential therapeutic agents targeting MC1R

These ELISA-based approaches provide valuable tools for both basic research on MC1R biology and translational applications in comparative primate studies and melanoma research.

What are the future research directions for Trachypithecus obscurus MC1R studies?

The study of Melanocyte-stimulating hormone receptor (MC1R) in Trachypithecus obscurus represents a promising field with several important future research directions:

  • Evolutionary and Ecological Studies:

    • Comprehensive sampling across the full geographic range of Trachypithecus obscurus to correlate MC1R variation with subspecies differentiation and habitat types

    • Integration of MC1R data with whole-genome analyses to understand the broader context of pigmentation gene evolution in primates

    • Investigation of parallel evolution in MC1R across primate lineages adapting to similar environments

  • Functional Genomics Approaches:

    • CRISPR-based editing to introduce Trachypithecus obscurus MC1R variants into model systems

    • Single-cell transcriptomics to understand MC1R expression patterns in different cell types

    • Chromatin immunoprecipitation studies to identify transcription factors regulating MC1R expression

  • Translational Research Applications:

    • Development of MC1R-targeted imaging agents for melanoma detection based on insights from comparative primate studies

    • Investigation of DNA repair functions of MC1R in different primate species as models for human skin cancer biology

    • Exploration of species differences in MC1R pharmacology to improve specificity of melanoma therapeutics

  • Methodological Advancements:

    • Development of primate-specific antibodies with improved specificity for different MC1R variants

    • Advanced structural biology approaches (cryo-EM, X-ray crystallography) to resolve Trachypithecus obscurus MC1R structure

    • Improved recombinant expression systems for functional studies of membrane proteins

  • Integrative Multi-omics Approaches:

    • Combination of genomics, transcriptomics, and proteomics to understand MC1R regulation

    • Systems biology modeling of MC1R signaling networks across primate species

    • Metabolomics analysis of melanin production pathways in relation to MC1R variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.