The Melanocyte-stimulating hormone receptor (MC1R) in Trachypithecus obscurus (also known as Dusky leaf-monkey or Presbytis obscura) is a G-protein coupled receptor involved in pigmentation regulation. It is a full-length protein comprising 317 amino acids with UniProt accession number Q864I5 . MC1R belongs to the G-protein coupled receptor 1 family, similar to its homologs in other species, and functions as a receptor for melanocyte-stimulating hormones (MSH). In primates, as in other vertebrates, this receptor plays a crucial role in regulating the production of melanin pigments, influencing coat color and skin pigmentation characteristics .
Trachypithecus obscurus is a primate species that inhabits tropical rainforests in Peninsular Malaysia, Thailand, and Myanmar, with at least five morphologically described subspecies distributed throughout these regions . The study of MC1R in this species provides valuable insights into primate evolution and adaptive pigmentation mechanisms.
The MC1R protein shows considerable conservation between Trachypithecus obscurus and humans, reflecting its evolutionary importance in vertebrate pigmentation. The human MC1R is also 317 amino acids in length and functions similarly as a receptor for MSH (alpha, beta, and gamma) and ACTH . In humans, MC1R activity is mediated by G proteins that activate adenylate cyclase, leading to increased cAMP production which ultimately regulates melanogenesis .
Sequence comparison reveals high conservation in functional domains, particularly in the transmembrane regions and ligand-binding sites. The comparative amino acid sequences show:
| Species | Sequence Excerpt (Representative Region) | Key Functional Domains |
|---|---|---|
| T. obscurus | MPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVVVAIARNRNLHSPMYCFICCLALSDLLVSGSN... | Transmembrane domains, G-protein binding sites, ligand-binding pocket |
| Human | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVVATIAKNRNLHSPMYCFICCLALSDLLVSGSN... | Transmembrane domains, G-protein binding sites, ligand-binding pocket |
Both proteins function through similar molecular mechanisms, with activity mediated by G proteins that activate adenylate cyclase . The patterns of amino acid substitution across different regions of the receptor are similar to patterns seen in mammals, suggesting comparable levels of constraint and a conserved function for MC1R across primate species .
For optimal maintenance of recombinant Trachypithecus obscurus MC1R protein stability and activity, the following storage and handling conditions are recommended:
Storage buffer: Tris-based buffer containing 50% glycerol, specifically optimized for this protein
Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it may lead to protein degradation and loss of activity
When working with the recombinant protein, it is advisable to aliquot the stock solution into smaller volumes upon first thawing to minimize freeze-thaw cycles. The presence of 50% glycerol in the storage buffer helps prevent freeze-thaw damage and maintains protein stability. For experimental applications, it is recommended to dilute the protein in an appropriate buffer immediately before use.
Several methodological approaches are employed to study MC1R expression and activity in research settings:
Protein Expression Analysis:
Quantitative immunofluorescence: Allows precise measurement of MC1R expression levels not discernible by standard immunohistochemistry
Immunohistochemistry (IHC): Used to detect MC1R protein in tissue sections
Western blotting (WB): For quantification of MC1R protein levels in cell or tissue lysates
Functional Assays:
Genetic Analysis:
Recombinant Protein Applications:
These methods can be applied to investigate MC1R in Trachypithecus obscurus tissue samples, cell cultures, or using recombinant proteins to understand the receptor's role in pigmentation and other physiological processes.
MC1R polymorphisms provide valuable insights into primate adaptation and evolution, particularly regarding pigmentation phenotypes and their ecological significance:
Adaptive Color Variation:
Studies of MC1R across vertebrates have shown that this gene plays a crucial role in adaptive color variation. In reptiles, for example, MC1R polymorphisms are strongly associated with color differences that relate to adaptation to different colored substrates or thermal environments . Similar principles may apply to primate evolution, where coat color could be adaptive for camouflage, thermoregulation, or social signaling.
Molecular Signatures of Selection:
Analysis of MC1R sequences can reveal signatures of natural selection. Patterns observed in some species include:
Population Structure and Speciation:
In Trachypithecus obscurus, molecular data has been used to differentiate subspecies that are morphologically similar . MC1R polymorphisms, when combined with other genetic markers, can help reconstruct population histories and processes of subspeciation in primates.
Comparative Evolutionary Rates:
High levels of silent-site heterozygosity have been observed in MC1R across various species, consistent with a high mutation rate or large long-term effective population size . Comparing these patterns in Trachypithecus obscurus with other primates can provide insights into evolutionary dynamics.
The study of MC1R polymorphisms in Trachypithecus obscurus populations could therefore illuminate how different selective pressures have shaped coat color evolution in relation to their forest habitat requirements across their range in Southeast Asia.
Research on Trachypithecus obscurus MC1R has potential translational applications in melanoma studies through several avenues:
Comparative Receptor Function and Signaling:
Understanding the structural and functional differences between human and non-human primate MC1R can provide insights into the evolution of melanoma susceptibility. MC1R plays a critical role in human pigmentation and DNA repair mechanisms, with its expression levels showing a stepwise elevation during melanoma progression from benign nevi to metastatic melanoma . Comparative studies could identify conserved domains critical for these functions.
Development of MC1R-Targeted Therapies:
MC1R-targeting agents are being investigated in clinical trials for melanoma patients . Recombinant Trachypithecus obscurus MC1R could serve as a model system for testing the specificity and cross-reactivity of these agents:
Alpha-particle emitting therapies targeting MC1R have shown promise in preclinical studies, with [225Ac]Ac-DOTA-MC1RL demonstrating prolonged survival and tumor growth delay in uveal melanoma xenografts
These therapies can remodel the tumor microenvironment and increase the fractions of immune cells, suggesting potential combination with immunotherapy
MC1R-Based Immunotherapy Development:
MC1R-derived peptides can induce responses from cytotoxic T lymphocytes and tumor infiltrating lymphocytes, suggesting potential for MC1R-targeted melanoma therapeutic vaccines . Comparative analysis of primate MC1R epitopes could help identify highly conserved regions most likely to be effective targets.
Biomarker Development:
The correlation between MC1R expression and melanoma progression suggests its potential as a prognostic biomarker. Higher MC1R expression is seen in deeper primary lesions (>1 mm), ulcerated lesions, and mucosal melanomas compared to cutaneous melanomas, and is associated with shorter survival in primary and metastatic tumors . Comparative studies could help validate these findings across species.
Advanced imaging techniques offer powerful approaches to investigate MC1R distribution in primate tissue samples:
Quantitative Immunofluorescence:
This technique allows precise measurement of MC1R expression levels in a fashion not discernible by standard immunohistochemistry . The methodology involves:
Tissue microarray construction for high-throughput analysis
Fluorophore-conjugated antibodies targeting MC1R
Digital image acquisition and quantitative analysis
Normalization to control proteins for comparative analysis
Multiplex Immunofluorescence:
This approach enables simultaneous visualization of MC1R with other proteins of interest to study:
Co-localization with melanocyte markers
Association with signaling pathway components
Relationship to cell proliferation or apoptosis markers
Distribution relative to tissue microenvironment components
Confocal Microscopy:
Provides high-resolution three-dimensional imaging of MC1R distribution:
Z-stack imaging to reconstruct 3D protein distribution
Co-localization analysis with subcellular markers
Live-cell imaging of recombinant fluorescent-tagged MC1R
Advanced Analytical Approaches:
Tissue cytometry: Combines flow cytometry principles with tissue imaging
Spatial transcriptomics: Correlates MC1R protein expression with local gene expression profiles
Image analysis algorithms: Quantifies expression patterns across different tissue regions
These methods can be applied to comparative studies between human and non-human primate tissue samples to better understand the evolutionary conservation of MC1R distribution and its relationship to pigmentation patterns and melanoma susceptibility.
When investigating MC1R signaling pathways in primate cells, researchers should consider the following experimental design factors:
Cell System Selection:
Primary melanocytes vs. established cell lines: Primary cells better represent physiological conditions but are challenging to maintain
Immortalized melanocyte lines: More stable but may have altered signaling pathways
Heterologous expression systems: Allow controlled expression but lack the natural cellular context
Comparative approach using both Trachypithecus obscurus and human cells: Enables evolutionary insights
Receptor Expression Considerations:
Endogenous vs. recombinant expression: Endogenous provides physiological relevance, while recombinant allows controlled experiments
Expression level verification: Western blotting, flow cytometry, or quantitative immunofluorescence
Potential for receptor polymorphisms: Sequencing verification of the MC1R gene in the cell system
Signaling Pathway Analysis:
cAMP measurement: Primary second messenger activated by MC1R
Downstream effector phosphorylation: PKA, CREB, and MITF activation
Temporal resolution: Both immediate and delayed signaling events
Dose-response relationships: Full range of ligand concentrations
Cross-talk with other pathways: Interactions with other melanocyte signaling systems
Experimental Controls:
Functional Outcomes Assessment:
A well-designed experimental approach should incorporate multiple complementary methods to comprehensively characterize MC1R signaling, ideally comparing results across different primate species to identify conserved and divergent aspects of the signaling pathway.
The conservation of MC1R sequences across primate species provides valuable insights into the evolutionary pressures acting on pigmentation genes:
Sequence Conservation Patterns:
Comparison of MC1R sequences between Trachypithecus obscurus and other primates reveals high conservation in functional domains, particularly in:
Transmembrane domains
Ligand-binding regions
G-protein coupling sites
Intracellular signaling domains
The patterns of amino acid substitution across different regions of the receptor are similar to patterns seen in mammals, suggesting comparable levels of constraint and probably a conserved function for MC1R across primates .
Comparative Sequence Analysis:
When comparing the amino acid sequences of MC1R across primates, we observe:
| Species | Sequence Identity with Human MC1R | Key Differences |
|---|---|---|
| Trachypithecus obscurus | ~90% | Variations primarily in N-terminal region and third intracellular loop |
| Pan troglodytes (Chimpanzee) | ~99% | Few substitutions, mostly in non-functional regions |
| Macaca mulatta (Rhesus macaque) | ~95% | Variations in extracellular domains |
Evolutionary Rate Analysis:
High levels of silent-site heterozygosity have been observed in MC1R across various species, consistent with a high mutation rate or large long-term effective population size . This pattern extends to primate MC1R genes, though with variations that may reflect different selective pressures.
Functional Domain Conservation:
The most highly conserved regions across primates correspond to functional domains essential for:
MSH binding
G-protein coupling
Receptor activation
Signal transduction
These patterns of conservation highlight the fundamental importance of MC1R function in primate biology and suggest potential constraints on evolutionary divergence.
Investigating MC1R's role in primate coat color evolution requires a multidisciplinary approach combining molecular genetics, comparative biology, and evolutionary analysis:
Comparative Sequence Analysis:
Complete MC1R sequencing across diverse primate species with varying coat colors
Identification of polymorphisms associated with color phenotypes
Phylogenetic analysis to map color changes onto primate evolutionary trees
Tests for selection (dN/dS ratios, McDonald-Kreitman tests) to identify adaptive evolution
Phenotype-Genotype Association Studies:
Sampling across subspecies with different coat colors (e.g., the five morphological subspecies of Trachypithecus obscurus in Peninsular Malaysia)
Statistical association between MC1R variants and quantitative measures of coat color
Control for population structure using neutral genetic markers
Analysis of linkage disequilibrium patterns to detect recent selection
Functional Characterization of MC1R Variants:
Heterologous expression of primate MC1R variants in cell culture systems
Measurement of cAMP production in response to MSH stimulation
Quantification of eumelanin vs. pheomelanin production
Site-directed mutagenesis to test specific amino acid contributions to function
Ecological Correlation Studies:
Mapping MC1R variation against habitat types, predation pressure, and climate variables
Testing hypotheses about adaptive significance of coat color variation
Comparative analysis of selection patterns across different primate lineages
Integration with data on other pigmentation genes (ASIP, TYR, TYRP1, etc.)
Ancient DNA and Museum Specimen Analysis:
Recovery of MC1R sequences from historical specimens
Reconstruction of temporal changes in allele frequencies
Correlation with historical habitat changes or selection pressures
These approaches, when integrated, can provide a comprehensive understanding of how MC1R variation has contributed to the evolution of coat color diversity across primates, with particular relevance to understanding subspeciation in Trachypithecus obscurus.
Producing functionally active recombinant Trachypithecus obscurus MC1R requires careful consideration of expression systems and purification methods:
Expression System Selection:
Several expression systems can be used, each with advantages and limitations:
Optimized Protocol Components:
Codon optimization for the selected expression system
Addition of appropriate affinity tags (His, FLAG, etc.) for purification
Signal peptide optimization for membrane targeting
Inclusion of stabilizing mutations if needed for structural integrity
Expression temperature and induction conditions optimization
Solubilization and Purification Strategy:
Careful membrane solubilization using mild detergents (DDM, LMNG)
Affinity chromatography using metal chelation or antibody-based methods
Size exclusion chromatography for final purification
Quality control by SDS-PAGE, Western blotting, and mass spectrometry
Functional Validation Methods:
Ligand binding assays using radiolabeled or fluorescent MSH derivatives
Reconstitution into lipid nanodiscs or proteoliposomes
G-protein coupling assays
cAMP accumulation measurements in reconstituted systems
Storage Conditions:
For optimal stability, the purified recombinant protein should be stored in Tris-based buffer with 50% glycerol at -20°C for routine use or -80°C for long-term storage . Working aliquots can be maintained at 4°C for up to one week .
These methodological considerations are essential for producing recombinant Trachypithecus obscurus MC1R that retains its native structure and function for downstream applications in evolutionary, structural, and pharmacological studies.
ELISA-based approaches offer versatile tools for studying Trachypithecus obscurus MC1R in research settings:
Direct Detection ELISA:
Competitive Binding ELISA:
Measures the interaction between MC1R and its ligands (MSH variants, ACTH)
Uses labeled and unlabeled ligands competing for receptor binding
Enables determination of binding affinities and kinetics
Can detect species-specific differences in ligand recognition
Phospho-ELISA for Signaling:
Measures downstream phosphorylation events following MC1R activation
Targets phosphorylated CREB or other signaling intermediates
Provides quantitative measure of receptor functionality
Allows comparison of signaling efficiency between variants
Optimized Protocol Components:
Coating: Recombinant Trachypithecus obscurus MC1R at 1-10 μg/ml
Blocking: 1-5% BSA or casein to minimize background
Primary antibody: Species-specific anti-MC1R or cross-reactive antibodies
Detection: HRP-conjugated secondary antibody with TMB or other substrates
Applications in Comparative Studies:
Quantitative comparison of MC1R expression across primate species
Evaluation of antibody cross-reactivity between human and non-human primate MC1R
Assessment of evolutionary conservation of epitopes
Screening of potential therapeutic agents targeting MC1R
These ELISA-based approaches provide valuable tools for both basic research on MC1R biology and translational applications in comparative primate studies and melanoma research.
The study of Melanocyte-stimulating hormone receptor (MC1R) in Trachypithecus obscurus represents a promising field with several important future research directions:
Evolutionary and Ecological Studies:
Comprehensive sampling across the full geographic range of Trachypithecus obscurus to correlate MC1R variation with subspecies differentiation and habitat types
Integration of MC1R data with whole-genome analyses to understand the broader context of pigmentation gene evolution in primates
Investigation of parallel evolution in MC1R across primate lineages adapting to similar environments
Functional Genomics Approaches:
CRISPR-based editing to introduce Trachypithecus obscurus MC1R variants into model systems
Single-cell transcriptomics to understand MC1R expression patterns in different cell types
Chromatin immunoprecipitation studies to identify transcription factors regulating MC1R expression
Translational Research Applications:
Development of MC1R-targeted imaging agents for melanoma detection based on insights from comparative primate studies
Investigation of DNA repair functions of MC1R in different primate species as models for human skin cancer biology
Exploration of species differences in MC1R pharmacology to improve specificity of melanoma therapeutics
Methodological Advancements:
Development of primate-specific antibodies with improved specificity for different MC1R variants
Advanced structural biology approaches (cryo-EM, X-ray crystallography) to resolve Trachypithecus obscurus MC1R structure
Improved recombinant expression systems for functional studies of membrane proteins
Integrative Multi-omics Approaches:
Combination of genomics, transcriptomics, and proteomics to understand MC1R regulation
Systems biology modeling of MC1R signaling networks across primate species
Metabolomics analysis of melanin production pathways in relation to MC1R variants