Recombinant Tragelaphus imberbis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tragelaphus imberbis (Lesser kudu)
Target Names
Target Protein Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETVWTILPAVILIMIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRVLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFEKWSASML
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a crucial component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. MT-CO2 plays a vital role in this process. Within CIV, it contributes to the dinuclear copper A center (CuA) and the electron transfer pathway to the binuclear center (BNC), which catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via CuA and heme A to the BNC (heme a3 and CuB), where oxygen reduction occurs, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase Subunit 2 (MT-CO2) and what is its function in cellular respiration?

Cytochrome c oxidase subunit 2 (MT-CO2), encoded by the COII gene, is a highly conserved protein that forms an essential component of Complex IV in the mitochondrial electron transport chain. It plays a critical role in cellular respiration by facilitating the initial transfer of electrons from cytochrome c to the cytochrome c oxidase (COX) complex, which is crucial for the production of ATP . The protein contains specific binding sites for redox-active copper ions (CuA), which are essential for its electron transfer function .

MT-CO2 acts as an interface between the electron donor (cytochrome c) and the catalytic core of COX. The protein contains several conserved functional domains including:

  • Copper-binding sites involving two Cys and two His residues

  • Four invariant acidic amino acid residues (two Asp and two Glu) that may mediate interactions with cytochrome c

  • A conserved region of aromatic residues (Tyr-Gln-Trp-Tyr-Trp-Gly-Tyr-Glu-Tyr) postulated to play a role in electron transfer

Defects in MT-CO2 can lead to severe metabolic disorders due to impaired oxidative phosphorylation, highlighting its critical role in energy metabolism .

How does MT-CO2 from Tragelaphus imberbis compare with homologous proteins from other species?

While specific sequence data for Tragelaphus imberbis MT-CO2 is not provided in the search results, comparative analyses of MT-CO2 across species reveal important patterns of conservation and divergence. Based on studies of other species, we can infer several characteristics:

  • High conservation of functional domains - The copper-binding sites and electron transfer domains are likely highly conserved in T. imberbis MT-CO2, as these are essential for function .

  • Species-specific variations in non-catalytic regions - As observed in other species comparisons, T. imberbis MT-CO2 likely shows sequence divergence in regions not directly involved in catalysis.

  • Transmembrane topology - Similar to other mammals, T. imberbis MT-CO2 likely contains two transmembrane helices, rather than the three seen in bacterial homologs like R. sphaeroides .

What expression systems are typically used for recombinant MT-CO2 production?

Recombinant MT-CO2 is typically produced using prokaryotic expression systems, with E. coli being the most commonly employed host organism . The expression process generally involves:

  • Gene synthesis or cloning of the MT-CO2 coding sequence into an appropriate expression vector

  • Addition of affinity tags (commonly His-tags) to facilitate purification

  • Transformation into a suitable E. coli strain optimized for membrane protein expression

  • Induction of protein expression under controlled conditions

  • Cell lysis and membrane fraction isolation

  • Detergent solubilization of the membrane-bound protein

  • Affinity chromatography purification

  • Optional tag removal and secondary purification steps

For example, a recombinant Arvicanthis somalicus MT-CO2 has been successfully produced in E. coli with an N-terminal His-tag, resulting in a purified protein with greater than 90% purity as determined by SDS-PAGE .

When working with mammalian MT-CO2 proteins, special consideration must be given to the hydrophobic nature of this membrane protein. Optimization of detergents for solubilization and stability is critical for obtaining functional protein. For functional studies, reconstitution into liposomes or nanodiscs may be necessary to provide an appropriate lipid environment.

What are the standard purification and storage methods for recombinant MT-CO2?

Standard purification and storage protocols for recombinant MT-CO2 typically follow these methodological approaches:

Purification:

  • Initial purification via affinity chromatography (typically using His-tag)

  • Quality assessment by SDS-PAGE with purity targets >90%

  • Optional secondary purification via size exclusion or ion exchange chromatography

  • Buffer exchange to remove elution agents

Storage conditions:

  • Lyophilization in the presence of stabilizing agents (e.g., 6% trehalose)

  • Storage of lyophilized powder at -20°C/-80°C

  • For working solutions, reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of glycerol (20-50% final concentration) to prevent freeze-thaw damage

  • Aliquoting to avoid repeated freeze-thaw cycles

  • Long-term storage at -80°C; short-term (1 week) at 4°C

As observed with the Arvicanthis somalicus MT-CO2 recombinant protein, storage buffers typically contain Tris/PBS-based components with stabilizers like trehalose at pH 8.0 . The exact buffer composition may need to be optimized for the specific properties of T. imberbis MT-CO2.

It is critical to minimize repeated freeze-thaw cycles as these can significantly reduce protein activity and stability. For researchers using recombinant MT-CO2 in enzymatic assays, it's advisable to prepare small working aliquots that can be used within one week when stored at 4°C.

How can researchers assess the functional integrity of recombinant T. imberbis MT-CO2?

Assessing the functional integrity of recombinant MT-CO2 requires multiple complementary approaches:

Structural integrity assessments:

  • Circular Dichroism (CD) spectroscopy to verify secondary structure content

  • Fluorescence spectroscopy to assess tertiary structure integrity

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS) to confirm proper oligomeric state

Functional assays:

  • Electron transfer activity - Measure electron transfer from reduced cytochrome c to oxygen using spectrophotometric assays that monitor the oxidation of cytochrome c at 550 nm

  • Copper binding capacity - Assess copper integration using atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS)

  • Protein-protein interaction assays - Evaluate binding to other COX subunits and to cytochrome c using surface plasmon resonance or microscale thermophoresis

When assessing electron transfer activity, researchers should compare the kinetic parameters (KM and Vmax) of recombinant T. imberbis MT-CO2 with those of native protein when possible, or with recombinant proteins from closely related species. Typical enzyme kinetic parameters for MT-CO2 from various species show KM values for cytochrome c in the micromolar range, though these can vary significantly based on experimental conditions and species.

For comprehensive functional validation, reconstitution of recombinant MT-CO2 with other COX subunits to form a functional complex provides the most definitive assessment of proper folding and activity.

What are the critical factors affecting the expression and folding of recombinant MT-CO2?

Several critical factors influence the successful expression and proper folding of recombinant MT-CO2:

Expression system optimization:

  • Codon optimization for the expression host

  • Selection of appropriate promoter strength to balance expression level with folding capacity

  • Growth temperature modulation (typically lowered to 16-25°C during induction)

  • Induction conditions (inducer concentration and duration)

  • Co-expression with molecular chaperones

Membrane protein-specific considerations:

  • Addition of membrane-targeting signals if needed

  • Selection of E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Supplementation with copper to ensure proper metallation of the CuA site

  • Careful selection of detergents for solubilization that preserve the native-like structure

The transmembrane topology of MT-CO2 presents specific challenges. While mammalian MT-CO2 typically contains two transmembrane helices, bacterial homologs like R. sphaeroides may have a third helix that functions as part of a signal sequence . This structural difference must be considered when designing expression constructs.

For T. imberbis MT-CO2, researchers should be particularly attentive to the copper coordination sites, as proper metallation is essential for function. Supplementing growth media with copper and ensuring appropriate oxidation conditions can significantly improve the yield of correctly folded, functionally active protein.

How can researchers investigate the evolutionary selection pressures on T. imberbis MT-CO2?

Investigating evolutionary selection pressures on T. imberbis MT-CO2 requires sophisticated molecular evolutionary analyses. A comprehensive methodological approach includes:

Sequence-based analyses:

  • Multiple sequence alignment of MT-CO2 from T. imberbis with orthologs from related species

  • Calculation of nonsynonymous to synonymous substitution ratios (ω = dN/dS) using maximum likelihood models of codon substitution

  • Identification of sites under purifying selection (ω << 1), neutral evolution (ω ≈ 1), or positive selection (ω > 1)

  • Application of branch-site models to detect lineage-specific selection pressures

Structural and functional correlation:

  • Mapping selected sites onto the 3D protein structure

  • Correlation of selection patterns with functional domains

  • Assessment of co-evolution with interacting proteins (e.g., nuclear-encoded COX subunits)

Studies in other species have revealed that the majority of MT-CO2 codons are typically under strong purifying selection (ω << 1), reflecting functional constraints, while approximately 4% of sites may evolve under relaxed selective constraint (ω = 1) . The copper-binding sites and electron transfer domains are expected to be under the strongest purifying selection.

For T. imberbis specifically, researchers should examine whether unique environmental adaptations have driven positive selection in specific regions of MT-CO2. For example, adaptations to high-altitude environments or other extreme conditions might be reflected in the evolutionary history of this protein.

What methodologies are available for studying interactions between recombinant MT-CO2 and other components of the respiratory chain?

Studying interactions between recombinant MT-CO2 and other respiratory chain components requires sophisticated biochemical and biophysical approaches:

Protein-protein interaction methodologies:

  • Co-immunoprecipitation using antibodies against MT-CO2 or interaction partners

  • Surface Plasmon Resonance (SPR) to measure binding kinetics and affinity

  • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters of binding

  • Microscale Thermophoresis (MST) for interaction studies in solution

  • FRET/BRET assays for proximity-based interaction detection

Structural studies:

  • Cryo-electron microscopy of reconstituted complexes

  • X-ray crystallography of co-crystallized components

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Cross-linking mass spectrometry to identify proximal residues between proteins

Functional interaction studies:

  • Reconstitution assays with purified components to measure restored activity

  • Enzyme kinetics in the presence and absence of interacting partners

  • Mutational analysis of interface residues to disrupt specific interactions

When studying MT-CO2 interactions, particular attention should be paid to its interaction with cytochrome c, which involves conserved acidic residues on MT-CO2 . The interaction between MT-CO2 and other COX subunits, particularly the nuclear-encoded ones, is also critical for understanding assembly and function of the complete enzyme complex.

For T. imberbis MT-CO2, comparative analysis of interaction patterns with those of better-characterized mammalian systems (such as bovine) can provide valuable insights into conserved and species-specific aspects of respiratory chain organization.

How does post-translational modification affect the function of MT-CO2, and how can these modifications be incorporated into recombinant systems?

Post-translational modifications (PTMs) significantly influence MT-CO2 function, and incorporating these into recombinant systems presents specific challenges:

Common PTMs affecting MT-CO2 function:

  • Metallation - Incorporation of copper into the CuA site is essential for electron transfer function

  • Phosphorylation - Can regulate enzyme activity and response to metabolic conditions

  • Oxidative modifications - May occur during stress conditions and affect activity

Impact of phosphorylation on function:
Research indicates that phosphorylation states can modulate COX activity in response to cellular signals. For example, studies have shown that PKA-mediated phosphorylation can affect COX activity and consequently ROS production . The table below summarizes potential effects of phosphorylation on MT-CO2 function:

Phosphorylation StateEffect on COX ActivityEffect on ROS ProductionEffect on OXPHOS Biogenesis
↑ Phosphorylation↑ Activity↓ ROS↓ Biogenesis
↓ Phosphorylation↓ Activity↑ ROS↑ Biogenesis

Incorporating PTMs in recombinant systems:

  • Copper incorporation:

    • Supplement expression media with copper

    • Co-express with copper chaperones

    • Perform in vitro copper reconstitution post-purification

  • Phosphorylation:

    • Co-express with relevant kinases

    • Perform in vitro phosphorylation with purified kinases

    • Use genetic code expansion for site-specific incorporation of phosphomimetic amino acids

  • Advanced eukaryotic expression systems:

    • Consider insect cell or mammalian cell expression systems for complex PTMs

    • Develop cell-free systems supplemented with PTM machinery

When working with T. imberbis MT-CO2, researchers should identify potential phosphorylation sites through comparative analysis with known sites in better-characterized species. Targeted mutagenesis of these sites (to either prevent or mimic phosphorylation) can provide insights into the regulatory mechanisms specific to this species.

What methodological approaches can be used to investigate the role of MT-CO2 mutations in metabolic disorders?

Investigating the role of MT-CO2 mutations in metabolic disorders requires an integrated approach combining molecular, cellular, and physiological methodologies:

Molecular characterization of mutations:

  • Site-directed mutagenesis to introduce specific mutations into recombinant T. imberbis MT-CO2

  • Structural analysis to predict impacts on protein folding and function

  • In vitro activity assays comparing wild-type and mutant proteins

  • Stability assays to assess effects on protein half-life

Cellular models:

  • Generation of cybrid cell lines harboring specific MT-CO2 mutations

  • CRISPR-based approaches for introducing mutations into cellular models

  • Measurement of cellular respiration parameters:

    • Oxygen consumption rate

    • ATP production

    • ROS generation

    • Mitochondrial membrane potential

Physiological significance assessment:

  • Analysis of heteroplasmy effects (percentage of mutant vs. wild-type mtDNA)

  • Study of compensatory mechanisms (e.g., OXPHOS biogenesis upregulation)

  • Investigation of tissue-specific effects of mutations

MT-CO2 mutations can have varying impacts on cellular function. In heteroplasmic COXI mutant cells (a model applicable to MT-CO2 mutations), studies have shown increased ROS production, elevated citrate synthase activity, and upregulation of PGC1α and NRF1 expression :

Cell TypeROS ProductionmtDNA ContentPGC1α ExpressionNRF-1 Expression
Wild-typeBaselineBaselineBaselineBaseline
Heteroplasmic mutantIncreasedIncreasedIncreasedIncreased
Homoplasmic mutantNot increasedNot increasedNot increasedNot increased

For T. imberbis MT-CO2, comparative analysis with human disease-causing mutations can provide insights into potential metabolic impacts. Conservation analysis can help identify which residues are likely to be functionally critical and thus predict which mutations might be most deleterious.

How can recombinant T. imberbis MT-CO2 be used in comparative evolutionary studies?

Recombinant T. imberbis MT-CO2 offers valuable opportunities for comparative evolutionary studies through several methodological approaches:

Functional evolution analysis:

  • Expression of recombinant MT-CO2 from multiple species (including T. imberbis) using identical systems

  • Standardized activity assays to compare kinetic parameters

  • Protein stability comparisons across temperature and pH ranges

  • Determination of binding affinities for interaction partners

Hybrid protein studies:

  • Creation of chimeric proteins combining domains from T. imberbis MT-CO2 with those from other species

  • Domain-swapping experiments to identify regions responsible for species-specific properties

  • Co-evolution analysis with interacting partners (e.g., cytochrome c, other COX subunits)

Molecular adaptation research:

  • Reconstruction of ancestral MT-CO2 sequences

  • Functional characterization of ancestral proteins compared to extant versions

  • Identification of positively selected sites that may represent adaptations to specific environments

Studies of MT-CO2 in marine copepods have revealed extensive interpopulation divergence (nearly 20% at the nucleotide level) , suggesting that even within a species, MT-CO2 can undergo significant adaptive evolution. For T. imberbis, comparison with other bovids can reveal adaptations specific to its ecological niche.

Importantly, comparative studies should account for potential co-evolution between mitochondrial-encoded MT-CO2 and nuclear-encoded interaction partners. The interaction between these proteins can drive compensatory mutations, as observed in studies of Tigriopus californicus .

What techniques are available for studying the assembly of MT-CO2 into the complete cytochrome c oxidase complex?

Studying the assembly of MT-CO2 into the complete cytochrome c oxidase complex requires sophisticated biochemical and cellular approaches:

In vitro reconstitution studies:

  • Purification of individual COX subunits, including recombinant T. imberbis MT-CO2

  • Stepwise assembly assays monitoring incorporation of subunits

  • Activity measurements at each assembly stage

  • Structural characterization of assembly intermediates using cryo-EM

Cellular assembly monitoring:

  • Pulse-chase experiments to track synthesis and assembly kinetics

  • Blue Native PAGE to separate assembly intermediates

  • Immunoprecipitation of assembly factors with nascent MT-CO2

  • Import assays using isolated mitochondria

Assembly factor identification:

  • Proximity labeling approaches (BioID, APEX) with MT-CO2 as bait

  • Co-purification of binding partners during assembly process

  • Genetic screens for factors affecting COX assembly

The complete cytochrome c oxidase complex consists of 3 mitochondrial DNA-encoded subunits and 10 nuclear-encoded subunits . The assembly process is highly regulated and requires numerous assembly factors. For T. imberbis MT-CO2, researchers should examine whether species-specific assembly factors exist or whether the conserved machinery found in other mammals is sufficient.

Assembly studies should pay particular attention to the incorporation of cofactors, especially the copper ions essential for MT-CO2 function. The CuA site in MT-CO2 contains two Cys and two His residues that coordinate copper , and proper metallation is crucial for assembly and function.

How can researchers analyze the impact of MT-CO2 phosphorylation on electron transport chain function?

Analyzing the impact of MT-CO2 phosphorylation on electron transport chain function requires a multi-faceted approach:

Identification and characterization of phosphorylation sites:

  • Mass spectrometry-based phosphoproteomics of native MT-CO2

  • Bioinformatic prediction of potential phosphorylation sites

  • In vitro phosphorylation assays with purified kinases

  • Generation of phosphomimetic (Ser/Thr to Asp/Glu) and phospho-null (Ser/Thr to Ala) mutants

Functional analysis of phosphorylation:

  • Electron transfer activity measurements comparing phosphorylated and non-phosphorylated forms

  • Oxygen consumption rate determination in reconstituted systems

  • ROS production assessment under different phosphorylation states

  • Conformational change analysis using hydrogen-deuterium exchange MS

Cellular signaling context:

  • Identification of signaling pathways modulating MT-CO2 phosphorylation

  • Manipulation of cellular cAMP levels to alter PKA activity

  • Treatment with phosphatase inhibitors to maintain phosphorylation state

Studies have shown that PKA signaling can modulate COX activity, with implications for ROS production and OXPHOS biogenesis . Treatment with 8Br-cAMP (a PKA activator) decreased ROS production by stimulating COX activity, while H89 (a PKA inhibitor) increased ROS production in wild-type cells .

For T. imberbis MT-CO2, researchers should determine whether the phosphorylation sites are conserved compared to better-characterized species and whether the functional consequences of phosphorylation are species-specific or conserved across bovids or mammals more broadly.

What approaches can be used to study the interaction between MT-CO2 and cytochrome c?

The interaction between MT-CO2 and cytochrome c is critical for electron transport chain function and can be studied using several complementary approaches:

Binding and kinetic studies:

  • Surface Plasmon Resonance (SPR) to measure binding kinetics and affinity

  • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

  • Microscale Thermophoresis (MST) for interaction studies in solution

  • Steady-state enzyme kinetics to determine KM and kcat values

Structural characterization:

  • Co-crystallization attempts for X-ray crystallography

  • Cryo-EM studies of the complex

  • NMR studies of the interaction interface using labeled proteins

  • Computational docking and molecular dynamics simulations

Mapping the interaction interface:

  • Hydrogen-deuterium exchange mass spectrometry to identify protected regions

  • Cross-linking mass spectrometry to identify proximity relationships

  • Alanine scanning mutagenesis of acidic residues in MT-CO2

  • Chemical modification of surface residues to identify critical functional groups

The interaction between MT-CO2 and cytochrome c likely involves the four invariant acidic amino acid residues (two Asp and two Glu) that have been identified in studies of other species . Additionally, the region of aromatic residues (Tyr-Gln-Trp-Tyr-Trp-Gly-Tyr-Glu-Tyr) may play a role in electron transfer .

For T. imberbis MT-CO2, researchers should compare binding parameters with cytochrome c from the same species versus cytochrome c from other species to determine the degree of co-evolution and specificity in this interaction. Differences in binding affinity or electron transfer rates could indicate adaptation to specific metabolic requirements.

How can researchers develop assays to measure electron transfer activity of recombinant MT-CO2?

Developing robust assays to measure the electron transfer activity of recombinant T. imberbis MT-CO2 requires careful consideration of experimental conditions:

Spectrophotometric assays:

  • Cytochrome c oxidation assay - Monitor the decrease in absorbance at 550 nm as reduced cytochrome c is oxidized

  • Oxygen consumption assay - Use oxygen electrodes to measure consumption rates

  • Artificial electron acceptor assays - Employ redox-sensitive dyes as alternative electron acceptors

Electrochemical approaches:

  • Protein film voltammetry with immobilized MT-CO2

  • Mediated electrochemistry using soluble redox mediators

  • Construction of MT-CO2-modified electrodes for direct electron transfer

Reconstituted systems:

  • Liposome reconstitution of MT-CO2 with other COX subunits

  • Nanodisc incorporation for a defined membrane environment

  • Integration into respiratory supercomplexes for more physiological context

A standardized cytochrome c oxidation assay protocol could include:

  • Buffer conditions: 50 mM potassium phosphate, pH 7.4, 100 mM KCl

  • Substrate: 50 μM reduced cytochrome c (reduction with sodium dithionite)

  • Enzyme: 10-50 nM reconstituted MT-CO2 or MT-CO2-containing COX complex

  • Measurement: Continuous monitoring of absorbance at 550 nm for 5 minutes

  • Controls: Heat-inactivated enzyme, assay in presence of cyanide (COX inhibitor)

When developing assays for T. imberbis MT-CO2, researchers should optimize conditions specifically for this protein, as pH optima, temperature sensitivity, and detergent compatibility may differ from other species. Comparative analysis with well-characterized mammalian systems (such as bovine) can provide valuable benchmarks for assay development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.