Recombinant Trametes versicolor Protein FDD123 (FDD123)

Shipped with Ice Packs
In Stock

Description

Production and Purification

FDD123 is produced via recombinant expression in multiple host systems, including E. coli, yeast, baculovirus, mammalian cells, and cell-free systems . The choice of host influences purification efficiency and downstream applications:

ParameterDetailsSource
Host SystemsE. coli, yeast, baculovirus, mammalian cells, cell-free expression
PurificationSDS-PAGE-based purity ≥85% (general) to >90% (His-tagged variants)
Expression VectorNot explicitly disclosed; likely optimized for specific hosts (e.g., pET for E. coli)

For E. coli-expressed variants, the protein is typically fused with an N-terminal His tag to facilitate nickel-affinity chromatography . Cell-free systems offer flexibility but may yield lower purity compared to traditional hosts .

Available Recombinant Products

Commercially available FDD123 variants differ primarily in host systems and sequence completeness:

Product TypeHost SystemSequencePurityTagSource
Full-LengthE. coli1–283 AA>90%His
Full-LengthYeast/Baculovirus/Mammalian1–283 AA≥85%Not specified
PartialE. coli/Yeast/Baculovirus/MammalianTruncated≥85%Not specified

His-tagged variants (e.g., RFL29119TF from Creative BioMart) are preferred for applications requiring affinity-based purification . Partial-length proteins may be tailored for specific studies but lack detailed functional characterization in current literature.

Research Applications and Functional Insights

While FDD123 itself has not been extensively studied for specific biological roles, its production and structural properties make it valuable for:

  • Protein Interaction Studies: The His tag enables easy immobilization for co-IP or pull-down assays .

  • Enzymatic Assays: Full-length variants retain native conformation for activity testing, though no documented catalytic functions exist .

  • Comparative Proteomics: Alignments with other Trametes versicolor proteins (e.g., polysaccharide peptides with antitumor activity ) may guide hypothesis-driven research.

Notably, Trametes versicolor-derived proteins like TV-AFB1D (aflatoxin-degrading enzyme) and polysaccharide peptides demonstrate bioactive properties , suggesting potential therapeutic or industrial roles for FDD123, pending further investigation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
FDD123; Protein FDD123; CvHSP30/1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Trametes versicolor (White-rot fungus) (Coriolus versicolor)
Target Names
FDD123
Target Protein Sequence
MGNSALDLNPPNATFHLSTHGSDWLWAAFSVFGVSLLTVVAWTFTRPRGARLFHQIAIVV LTTGSLAYFSMASDLGATPVPVEFRGEGTRQIWFVRYIQWFITFPLLLLELLLATGLSLS DIFTTLFMSIVLVITGLVAALVPSTYKWGYYTFGVSALFYIWYVLLWHGPHTTFAAGGVL RRGYILAAGYLSFLLLLYPIAWACAEGGNVISVTSEMIWYGILDIFAGPIFLFFFLWELR GVDYATFGLHSGKYTDKSAYAPNTAQAAGTVPATTSTGAAGNV
Uniprot No.

Target Background

Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and basic properties of Trametes versicolor Protein FDD123?

FDD123 is a 283-amino acid protein (UniProt: O74631) from Trametes versicolor with alternative nomenclature CvHSP30/1. The protein has a complete amino acid sequence beginning with MGNSALDLNPPNATFHLSTH and continuing through to TGAAGNV at the C-terminus . Based on sequence analysis, FDD123 contains transmembrane domains with distinctive hydrophobic regions, suggesting it may function as a membrane-associated protein. When expressed recombinantly, it is often produced with affinity tags (such as His-tag) to facilitate purification and analysis .

Research methodologies for basic characterization typically include:

  • SDS-PAGE for molecular weight confirmation

  • Western blotting for identity verification

  • Circular dichroism for secondary structure analysis

  • Size-exclusion chromatography for oligomeric state determination

How does FDD123 compare to other characterized proteins from Trametes versicolor?

Trametes versicolor produces numerous proteins with diverse functions, most notably laccases and other lignin-modifying enzymes. Unlike the well-characterized laccases (TvLac1-7) that have established roles in degradation of compounds like benzo[a]pyrene , FDD123's specific functional role has not been as extensively documented in available literature.

Comparative analysis reveals that while laccases from T. versicolor demonstrate variable expression patterns in response to environmental stimuli (e.g., TvLac5 is rapidly induced by benzo[a]pyrene exposure while TvLac2 is repressed ), the regulation pattern of FDD123 would require specific investigation through transcriptomic and proteomic approaches similar to those used for laccase profiling.

What are the optimal expression systems for producing recombinant FDD123 protein?

Expression SystemAdvantagesLimitationsRecommended for FDD123
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, potential inclusion body formationInitial characterization studies
Yeast (P. pastoris)Eukaryotic post-translational modifications, secretory productionLonger production time, complex media requirementsFunctional studies requiring proper folding
Insect cellsAdvanced eukaryotic modifications, high-quality proteinExpensive, technically demandingStructural studies, protein-protein interaction analyses
Fungal expressionNative-like processing, potentially higher activityComplex development, lower yieldsEnzymatic activity studies

Methodology recommendations include:

  • Start with E. coli expression using BL21(DE3) or similar strains

  • Optimize induction conditions (IPTG concentration, temperature, duration)

  • Consider fusion partners (thioredoxin, MBP) if solubility issues arise

  • For complex studies, transition to eukaryotic systems for proper folding and modifications

What purification strategies yield the highest purity and activity of recombinant FDD123?

Purification of recombinant FDD123 requires a multi-step approach to achieve research-grade purity:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged FDD123

  • Intermediate purification: Ion exchange chromatography (typically anion exchange)

  • Polishing step: Size exclusion chromatography

Critical methodological considerations include:

  • Buffer composition should maintain protein stability (typically Tris-based buffer with 50% glycerol as used in commercial preparations )

  • Protease inhibitor cocktails should be included to prevent degradation

  • Verify purity through SDS-PAGE and Western blotting

  • Assess activity through appropriate functional assays (based on suspected functional role)

What is the putative biological function of FDD123 in Trametes versicolor?

Based on sequence analysis and our understanding of similar proteins in white-rot fungi, FDD123 (CvHSP30/1) likely functions as a stress response protein. The "HSP" designation in its alternative name suggests homology to heat shock proteins, which typically serve protective roles during cellular stress conditions.

While direct functional data for FDD123 is limited in the available literature, research on related fungal stress proteins suggests potential roles in:

  • Temperature adaptation

  • Oxidative stress response

  • Xenobiotic compound tolerance

  • Cellular membrane integrity maintenance during environmental stress

Methodological approaches to determine function include:

  • Gene knockout or knockdown studies to observe phenotypic changes

  • Transcriptomic analysis under various stress conditions

  • Protein-protein interaction studies to identify binding partners

  • Heterologous expression and complementation studies in model organisms

How might FDD123 contribute to the known biodegradative capabilities of Trametes versicolor?

Trametes versicolor demonstrates remarkable capabilities in degrading environmental pollutants, including high molecular weight polycyclic aromatic hydrocarbons like benzo[a]pyrene . While laccases are the primary enzymes studied for these activities, membrane-associated proteins like FDD123 might play supportive roles.

Potential contributions of FDD123 to biodegradative processes could include:

  • Cellular protection during exposure to toxic compounds

  • Membrane transport of degradation substrates or products

  • Signaling functions in stress response pathways

  • Stabilization of degradative enzyme complexes at the membrane interface

Research approaches to investigate these possibilities include:

  • Co-expression studies with known degradative enzymes

  • Metabolomic analysis of degradation pathways in FDD123 mutants

  • Localization studies to determine subcellular distribution during biodegradation

  • Protein engineering to enhance potential supportive functions

How does FDD123 expression change under various environmental conditions and stress factors?

Understanding the regulation of FDD123 expression would require transcriptomic and proteomic approaches similar to those used in studies of T. versicolor laccases . Based on methodologies used for related proteins, researchers should:

  • Design time-course experiments with various inducers (temperature shift, oxidative agents, xenobiotics)

  • Apply RNA-seq for transcriptome analysis

  • Use quantitative proteomics (LC-MS/MS) to measure protein levels

  • Develop qPCR assays for targeted expression analysis

A study design might include:

ConditionTreatment DurationAnalysis MethodsExpected Outcome
Heat stress (30°C vs 40°C)1h, 3h, 6h, 24hRNA-seq, qPCR, Western blotTemporal expression profile
Oxidative stress (H₂O₂)30min, 2h, 8hProteomics, Western blotProtein induction timeline
Xenobiotic exposure (BaP)4h, 12h, 24h, 48hRNA-seq, proteomicsComparison with laccase expression
Nutrient limitation24h, 48h, 72hTargeted qPCRStress response correlation

What protein-protein interactions might FDD123 participate in within the fungal cell?

Investigating the interactome of FDD123 would provide valuable insights into its functional role. Methodological approaches should include:

  • Yeast two-hybrid screening against a T. versicolor cDNA library

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity labeling approaches (BioID or APEX)

  • Fluorescence resonance energy transfer (FRET) with candidate interacting proteins

Data analysis should focus on:

  • Identification of interaction partners with known functions

  • Pathway enrichment analysis of interacting proteins

  • Correlation with stress response and biodegradation pathways

  • Structural modeling of interaction interfaces

How might FDD123 contribute to the medicinal properties observed in Trametes versicolor extracts?

Trametes versicolor extracts have demonstrated significant medicinal properties, including antioxidant and antibacterial activities as well as potential anticancer effects . While polysaccharides (PSP and PSK) have received the most attention for these properties, membrane proteins might play complementary roles.

To investigate FDD123's potential contribution to these properties, researchers should:

  • Perform activity assays with purified recombinant FDD123 against relevant targets

  • Compare antibacterial activity against organisms known to be sensitive to T. versicolor extracts (S. aureus, E. coli, P. aeruginosa)

  • Evaluate antioxidant potential through DPPH and ABTS radical scavenging assays

  • Assess anti-proliferative effects on cancer cell lines previously tested with T. versicolor extracts

What is the potential for engineering FDD123 for enhanced environmental bioremediation applications?

Given T. versicolor's established role in biodegradation of persistent pollutants like benzo[a]pyrene , engineered variants of FDD123 might enhance these capabilities. Research approaches should include:

  • Structure-guided mutagenesis to modify potential functional domains

  • Directed evolution screens for enhanced stress tolerance

  • Co-expression systems with known biodegradative enzymes

  • Development of immobilized enzyme systems for practical applications

Experimental design considerations:

  • High-throughput screening methods for engineered variants

  • Realistic pollutant mixtures rather than single compounds

  • Environmental condition variables (pH, temperature, co-contaminants)

  • Long-term stability and activity assessments

What are the key technical challenges in studying recombinant FDD123 protein?

Researchers working with FDD123 may encounter several technical challenges:

  • Solubility issues during recombinant expression

  • Maintaining native conformation and activity after purification

  • Developing specific activity assays without established functional knowledge

  • Distinguishing FDD123's effects from those of other T. versicolor proteins

Methodological solutions include:

  • Exploring multiple expression systems and fusion partners

  • Optimizing buffer conditions through thermal shift assays

  • Developing indirect activity measurements through stress response indicators

  • Using CRISPR-based approaches for gene deletion in the native organism

What emerging technologies might advance our understanding of FDD123's structure and function?

Future research on FDD123 would benefit from cutting-edge technologies:

TechnologyApplication to FDD123 ResearchExpected Insights
Cryo-electron microscopyHigh-resolution structural determinationMembrane interaction domains, functional sites
AlphaFold2/RoseTTAFoldComputational structure predictionPreliminary structural models for hypothesis generation
Single-cell proteomicsCell-to-cell variability in expressionHeterogeneity of stress responses in fungal populations
Native mass spectrometryProtein complex characterizationIdentification of stable interaction partners
Spatial transcriptomicsLocalized expression in fungal tissuesDistribution within fungal hyphae and fruiting bodies

Integrating these technologies would provide a comprehensive understanding of FDD123's role in T. versicolor biology and potential biotechnological applications.

What are the most promising research directions for FDD123 protein?

Based on current knowledge of T. versicolor biology and the limited specific information on FDD123, the most promising research directions include:

  • Comprehensive functional characterization through gene knockout and phenotypic analysis

  • Investigation of stress-response roles and potential applications in improving fungal stress tolerance

  • Exploration of roles in membrane processes related to xenobiotic degradation

  • Structure determination to enable rational engineering for enhanced properties

  • Integration into multi-enzyme systems for environmental bioremediation

How can researchers effectively collaborate to advance knowledge of FDD123 and related proteins?

Advancing knowledge of FDD123 will require interdisciplinary collaboration across:

  • Structural biologists for protein characterization

  • Fungal geneticists for in vivo function studies

  • Enzymologists for activity characterization

  • Environmental engineers for applied bioremediation research

  • Computational biologists for interactome and pathway analysis

Effective collaboration frameworks should include:

  • Standardized protocols for protein production and characterization

  • Open sharing of genetic constructs and mutant strains

  • Integrated databases of functional and structural data

  • Regular cross-disciplinary workshops and conferences

  • Collaborative funding proposals addressing fundamental and applied aspects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.