Recombinant Transmembrane protein 151 homolog (CBG00907)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes if necessary. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
CBG00907; Transmembrane protein 151 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-535
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
CBG00907
Target Protein Sequence
MAGTADCQEHVARPRRPNICRVLRRTGYGKCLICSLLLVLCFFYATYCHVKHEAYSGSQP LLIYQHGPCAQGYNFVPIVFGLMLYIVYLMECWHSRTKIINMKKVRVEDALDYITALRTS PPIVWWKSVCYHYTRKTRQVTRYRNGDAVSATQVYYERVNSHQAGSMFIYDTCGFRDISK SILEVEKFHVTRIRLTRSFVFANMQAATEFEQQRSRFFNDNETKDDYMEVREGMDLSDVG FVEEILAFNCPTPPWFLHPIVFWFFSILVLSWPLRIYTEWRTAVLSFQVVKLFGTHYLSP NSINYTGPLTRTSTMDTVELEALLRREQHFVVPSYSEVMLMQNTIANSNTNFPNLRFLEP VIQPRPLVNTTNEHIVLRNYGATDTENSEQSSTVIPRPPPLRVSRSMTFAEENNDENLGF LENGNRRNRAIPSRGTVPLRSLSIGGISAWSNGYREIGREDSQFLIEPDEPPPPYEVALR MCAPLYERLRRSISSRLASISHSSSKDLKSLTLKNNNGAANNNNNNNNENPEEQP
Uniprot No.

Target Background

Database Links

KEGG: cbr:CBG00907

Protein Families
TMEM151 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane protein 151 homolog (CBG00907) and what organism does it originate from?

Transmembrane protein 151 homolog (CBG00907) is a protein originally identified in Caenorhabditis briggsae, a nematode species. The protein is characterized by its transmembrane domains and is part of the larger transmembrane protein 151 family. The full-length protein consists of 535 amino acids and has the UniProt accession number Q626N3 . The protein contains multiple transmembrane domains which are critical for its insertion into biological membranes and subsequent function. Understanding the basic characteristics of this protein is essential for designing appropriate experimental procedures and interpretative frameworks.

How should CBG00907 recombinant protein be stored and handled to maintain stability?

For optimal stability of CBG00907 recombinant protein:

  • Store the protein at -20°C for routine storage, or at -80°C for extended storage periods.

  • The protein is supplied in a Tris-based buffer with 50% glycerol, optimized for stability.

  • Avoid repeated freeze-thaw cycles, as these can lead to protein degradation and loss of activity.

  • Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw damage.

  • When thawing, allow the protein to warm gradually on ice rather than at room temperature .

These storage conditions are designed to preserve protein structure and function. Improper storage can lead to protein aggregation, denaturation, or degradation, which would compromise experimental results. Researchers should validate protein integrity before use through methods such as SDS-PAGE or functional assays.

What are the critical considerations for designing experiments involving CBG00907?

When designing experiments involving CBG00907, researchers should implement several critical methodological approaches:

  • Randomization: Random allocation of experimental units to treatment groups is essential to reduce selection bias. Only 12% of biomedical studies report using randomization, yet it is crucial for ensuring that observed differences can be attributed to experimental manipulations . For CBG00907 studies, randomization should be applied to:

    • Selection of protein batches

    • Assignment of treatment conditions

    • Order of experimental procedures

  • Blinding: When qualitative assessments are involved (e.g., scoring phenotypes), blinding researchers to the experimental conditions reduces observer bias. Studies that incorporate blinding produce more accurate estimates of treatment effects .

  • Factorial Design: When multiple variables are being tested (e.g., protein concentration, temperature, pH), factorial designs allow for efficient testing of combinations, maximizing information while minimizing resource use .

  • Power Analysis: Determine appropriate sample sizes before beginning experiments to ensure statistical validity of results.

  • Controls: Include positive and negative controls, as well as appropriate vehicle controls when testing compounds that may interact with CBG00907.

Implementing these design elements significantly improves the validity and reproducibility of research findings with transmembrane proteins like CBG00907.

What expression systems are optimal for producing functional recombinant CBG00907?

The selection of an expression system for recombinant CBG00907 should be based on the protein's characteristics and experimental requirements:

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, rapid growth, inexpensiveLimited post-translational modifications, inclusion body formationStructural studies, antibody production
Insect cellsBetter folding of complex proteins, post-translational modificationsHigher cost, longer production timeFunctional studies requiring proper folding
Mammalian cellsMost native-like post-translational modificationsHighest cost, complex protocols, lower yieldInteraction studies, functional assays
Cell-free systemsRapid production, avoids toxicity issuesLimited scale, expensivePreliminary characterization, troubleshooting

For CBG00907 specifically, a transmembrane protein with multiple domains, insect or mammalian expression systems are often preferred to ensure proper folding and membrane insertion. The expression region for recombinant production typically includes amino acids 1-535 to capture the full-length protein . Codon optimization for the chosen expression system is recommended to maximize protein yield and quality.

What purification strategies are most effective for isolating CBG00907 while maintaining its native conformation?

Purifying transmembrane proteins like CBG00907 requires specialized approaches to maintain native conformation:

  • Membrane Protein Solubilization:

    • Select appropriate detergents (e.g., DDM, CHAPS, or digitonin) at concentrations above their critical micelle concentration

    • Test multiple detergents to identify optimal solubilization conditions

    • Consider using amphipols or nanodiscs for stabilization after extraction

  • Affinity Chromatography:

    • Utilize affinity tags incorporated during recombinant expression

    • Common tags include His6, FLAG, or GST, with His6 being particularly useful for transmembrane proteins

    • CBG00907 can be expressed with different tag types determined during the production process

  • Size Exclusion Chromatography:

    • Critical for separating properly folded protein from aggregates

    • Allows buffer exchange into final storage conditions

    • Can provide information about oligomeric state

  • Quality Control:

    • Assess purity by SDS-PAGE and Western blotting

    • Verify proper folding using circular dichroism or limited proteolysis

    • Evaluate functionality through binding or activity assays specific to transmembrane proteins

When storing purified CBG00907, maintain in Tris-based buffer with 50% glycerol at -20°C for standard storage or -80°C for long-term preservation .

How can researchers effectively study the membrane topology of CBG00907?

Determining the membrane topology of transmembrane proteins like CBG00907 requires multiple complementary approaches:

  • Computational Prediction:

    • Utilize algorithms like TMHMM, MEMSAT, or Phobius to predict transmembrane regions

    • Analysis of CBG00907's sequence suggests multiple hydrophobic regions likely to form transmembrane helices

    • Cross-validate predictions using multiple algorithms for consensus

  • Biochemical Methods:

    • Protease protection assays: Regions protected from proteolytic cleavage are likely embedded in the membrane

    • Glycosylation mapping: Adding glycosylation sites at various positions can identify lumenal/extracellular domains

    • Chemical labeling: Membrane-impermeable reagents label only extracellular/lumenal domains

  • Fluorescence-Based Approaches:

    • GFP-fusion analysis: Fluorescent proteins fold properly only in certain cellular compartments

    • FRET analysis between domains to determine relative positioning

  • Structural Studies:

    • Cryogenic electron microscopy for high-resolution structural information

    • X-ray crystallography if the protein can be crystallized

    • NMR for smaller domains or fragments

For CBG00907, combining computational prediction with experimental validation is essential, as the protein contains multiple potential transmembrane regions throughout its 535-amino acid sequence .

What techniques can be used to study protein-protein interactions involving CBG00907?

Multiple complementary techniques should be employed to comprehensively characterize protein-protein interactions involving CBG00907:

  • Co-immunoprecipitation (Co-IP):

    • Utilize antibodies against CBG00907 or potential interaction partners

    • Can be performed with endogenous proteins or recombinant tagged versions

    • Suitable for identifying stable interactions in native-like conditions

  • Proximity Labeling:

    • BioID or APEX2 fusion to CBG00907 can identify proximal proteins in living cells

    • Particularly valuable for transmembrane proteins like CBG00907 where interactions may be transient or dependent on membrane environment

  • Yeast Two-Hybrid Variants:

    • Split-ubiquitin membrane yeast two-hybrid specifically designed for membrane proteins

    • MYTH (Membrane Yeast Two-Hybrid) system allows screening for interactors of full-length transmembrane proteins

  • Crosslinking Mass Spectrometry:

    • Chemical crosslinking followed by mass spectrometry can identify interaction interfaces

    • Zero-length crosslinkers provide information about direct protein contacts

  • Förster Resonance Energy Transfer (FRET):

    • Allows detection of protein interactions in living cells

    • Can provide spatial and temporal information about interactions

What are the best approaches for characterizing the functional domains of CBG00907?

Characterizing the functional domains of CBG00907 requires systematic experimental approaches:

  • Domain Mapping Through Truncation and Mutation Analysis:

    • Generate systematic truncations and point mutations of CBG00907

    • Express these variants and assess for:

      • Proper folding and cellular localization

      • Ability to interact with known binding partners

      • Functional activity in relevant assays

    • The full CBG00907 sequence (amino acids 1-535) provides the foundation for designing these constructs

  • Chimeric Protein Analysis:

    • Create fusion proteins where domains of CBG00907 are replaced with corresponding domains from related proteins

    • Analyze which domains are necessary and sufficient for specific functions

  • Domain-Specific Antibodies or Ligands:

    • Develop tools that specifically recognize different domains

    • Use these to block or activate domain function

  • Structure-Function Correlation:

    • Combine structural information from computational modeling or experimental determination

    • Correlate with functional data to identify critical residues or motifs

  • Cross-Species Complementation:

    • Test whether CBG00907 can functionally replace homologous proteins in other species

    • Particularly valuable for comparing with human TMEM151A, which has been implicated in Paroxysmal Kinesigenic Dyskinesia

How does CBG00907 compare structurally and functionally to human TMEM151 proteins?

Comparative analysis between C. briggsae CBG00907 and human TMEM151 proteins reveals important evolutionary and functional relationships:

Understanding these relationships can guide experimental approaches when using CBG00907 as a model to study conserved functions of TMEM151 proteins across species, particularly in relation to neurological disorders like PKD.

What is the evolutionary significance of conserved domains in CBG00907 across species?

The evolutionary conservation of domains within CBG00907 provides valuable insights into protein function:

  • Phylogenetic Analysis:

    • CBG00907 belongs to the transmembrane protein 151 family, with homologs across metazoan species

    • Comparative genomic analyses reveal differential conservation of specific domains

    • Highly conserved regions typically indicate functional importance maintained through evolutionary pressure

  • Domain-Specific Conservation Patterns:

    • Transmembrane domains show higher conservation than cytoplasmic regions

    • Certain cytoplasmic motifs display strong conservation, suggesting functional importance

    • Variable regions may reflect species-specific adaptations

  • Functional Implications of Conservation:

    • Domains conserved between CBG00907 and human TMEM151A may relate to fundamental cellular processes

    • The involvement of human TMEM151A in neurological disorders like PKD suggests conservation of neuronal functions

    • Variability in certain regions may explain species-specific phenotypic differences

  • Evolutionary Rate Analysis:

    • Different domains evolve at different rates

    • Slowly evolving domains typically perform core functions

    • Rapidly evolving regions may be involved in species-specific interactions or adaptations

Understanding evolutionary conservation patterns can guide experimental design by highlighting domains most likely to be functionally significant, helping researchers prioritize regions for detailed functional studies.

What can CBG00907 research tell us about the pathophysiology of TMEM151A-related disorders in humans?

Research on CBG00907 can provide valuable insights into human TMEM151A-related disorders through comparative analysis:

  • Model System Advantages:

    • C. briggsae provides a simpler experimental system than mammalian models

    • Genetic manipulation is more straightforward, allowing for precise functional studies

    • High-throughput screening approaches can identify modifiers of CBG00907 function

  • Translational Relevance to PKD:

    • Human TMEM151A mutations account for approximately 6.9% of Paroxysmal Kinesigenic Dyskinesia (PKD) cases

    • TMEM151A variants produce a distinctive phenotype compared to other PKD-causing mutations:

      • Shorter duration dystonic episodes

      • No history of benign infantile epilepsy

      • Residual symptoms despite carbamazepine/oxcarbazepine treatment

  • Mechanism Exploration:

    • CBG00907 studies can investigate fundamental mechanisms of:

      • Protein trafficking and membrane localization

      • Channel or transporter functions

      • Signaling pathway involvement

    • Results can be validated in mammalian systems expressing human TMEM151A

  • Therapeutic Target Identification:

    • Understanding conserved functional domains between CBG00907 and human TMEM151A

    • Screening for compounds that modify CBG00907 function could identify potential therapeutic approaches

    • Validation in human cell models expressing TMEM151A variants

This translational approach requires rigorous experimental design, including randomization, appropriate controls, and blinding when conducting assessments, to ensure results are robust and reproducible .

How can CRISPR-Cas9 gene editing be optimized for studying CBG00907 function in C. briggsae?

Optimizing CRISPR-Cas9 gene editing for CBG00907 in C. briggsae requires specialized approaches:

  • Guide RNA Design and Validation:

    • Design multiple sgRNAs targeting different regions of the CBG00907 gene

    • Predict off-target effects using C. briggsae genome databases

    • Validate sgRNA efficiency using in vitro cleavage assays before organismal application

  • Delivery Methods for C. briggsae:

    • Microinjection into the gonad is the primary delivery method

    • Optimize injection mixture composition:

      • Cas9 protein (preferred over mRNA for higher efficiency)

      • sgRNA concentration (typically 50-100 ng/μl)

      • Repair template if making precise edits

      • Co-injection markers for selection

  • Editing Strategies:

    • Knockout: Design sgRNAs to create frameshift mutations

    • Knockin: Design homology-directed repair templates for:

      • Fluorescent protein tagging for localization studies

      • Introduction of specific mutations matching human disease variants

      • Addition of affinity tags for interaction studies

  • Screening and Validation Protocols:

    • PCR-based genotyping to identify editing events

    • Sequencing to confirm precise modifications

    • Western blotting to verify protein expression changes

    • Phenotypic characterization to assess functional consequences

  • Experimental Controls and Design:

    • Include proper controls such as non-targeting sgRNAs

    • Implement randomization in experimental procedures to reduce bias

    • Create multiple independent edited lines to control for off-target effects

When designing these experiments, researchers should also consider factorial designs to efficiently test multiple variables, maximizing information while minimizing animal use .

What methodological approaches can resolve contradictory findings in CBG00907 functional studies?

When facing contradictory findings in CBG00907 research, systematic methodological approaches can help resolve discrepancies:

  • Standardization of Experimental Conditions:

    • Develop standard operating procedures for key experiments

    • Control for variables that may affect outcomes:

      • Protein expression levels and tag position

      • Cell or tissue types used

      • Environmental conditions (temperature, pH, ionic strength)

    • Implement randomization and blinding to reduce experimental bias

  • Addressing Technical Artifacts:

    • Validate antibody specificity using knockout controls

    • Test multiple detection methods for protein-protein interactions

    • Control for overexpression artifacts with endogenous-level expression systems

    • Verify recombinant protein folding and functionality

  • Systematic Replication Studies:

    • Reproduce key findings using different:

      • Experimental approaches (orthogonal methods)

      • Reagents from independent sources

      • Laboratory environments (multi-lab collaboration)

    • Implement factorial design to efficiently test multiple variables simultaneously

  • Meta-analysis Approaches:

    • Quantitatively combine data from multiple studies

    • Weight findings based on methodological rigor

    • Identify patterns in conditions that produce different outcomes

  • Mechanistic Resolution:

    • Develop mechanistic hypotheses that could explain seemingly contradictory results

    • Design targeted experiments to test these hypotheses

    • Consider context-dependent functions that may explain different outcomes

This systematic approach aligns with best practices in experimental design and reporting as identified in the biomedical research literature .

How can single-molecule techniques be applied to study CBG00907 dynamics and interactions?

Single-molecule techniques offer powerful approaches to study the dynamics and interactions of transmembrane proteins like CBG00907:

  • Single-Molecule Fluorescence Microscopy:

    • Single-molecule FRET (smFRET) to measure conformational changes

      • Label specific domains of CBG00907 with donor and acceptor fluorophores

      • Monitor distance changes between domains in real-time

    • Single-particle tracking to measure:

      • Diffusion dynamics in membranes

      • Clustering behaviors

      • Interaction with other membrane components

  • Force Spectroscopy Techniques:

    • Atomic Force Microscopy (AFM):

      • Measure interaction forces between CBG00907 and binding partners

      • Probe mechanical properties of different domains

    • Optical or Magnetic Tweezers:

      • Study conformational changes under applied forces

      • Measure energetics of protein-protein interactions

  • Single-Channel Electrophysiology:

    • If CBG00907 forms or regulates ion channels:

      • Patch-clamp recordings to measure single-channel properties

      • Reconstitution in artificial bilayers for controlled environment studies

    • Correlation with mutations to identify functional domains

  • Experimental Design Considerations:

    • Sample preparation is critical:

      • Ensure protein maintains native conformation

      • Control surface attachment chemistry

      • Minimize fluorophore perturbation of function

    • Include appropriate controls:

      • Non-functional mutants

      • Randomized experimental order to prevent bias

      • Blinded analysis where applicable

  • Data Analysis Approaches:

    • Hidden Markov modeling to identify discrete states

    • Dwell-time analysis to determine kinetic parameters

    • Correlation analysis to identify coordinated movements

Single-molecule approaches can provide unique insights into CBG00907 function that would be masked in ensemble measurements, potentially revealing mechanisms relevant to related human disorders like PKD associated with TMEM151A mutations .

What are the most promising future directions for CBG00907 research?

Based on current knowledge and technological capabilities, several promising research directions for CBG00907 include:

  • Comparative Studies with Human TMEM151A:

    • Further exploration of structural and functional conservation between CBG00907 and human TMEM151A

    • Investigation of whether CBG00907 can complement TMEM151A deficiencies in mammalian models

    • Detailed characterization of how disease-causing mutations in human TMEM151A affect protein function

  • Systems Biology Approaches:

    • Integration of CBG00907 into protein interaction networks

    • Identification of genetic modifiers of CBG00907 function through screens

    • Multi-omics approaches to understand cellular responses to CBG00907 perturbation

  • Advanced Structural Studies:

    • Cryo-EM structures of CBG00907 in different conformational states

    • Determination of protein-protein interaction interfaces at atomic resolution

    • Molecular dynamics simulations to predict functional movements

  • Translational Applications:

    • Development of CBG00907 as a model system for screening compounds that may affect TMEM151A function

    • Investigation of CBG00907's potential role in neuronal excitability relevant to PKD

    • Exploration of gene therapy approaches that could be applied to TMEM151A-related disorders

Future research should implement rigorous experimental design principles, including randomization, blinding where appropriate, and factorial designs to efficiently test multiple variables . These approaches will maximize the translational value of CBG00907 research for understanding related human proteins and their associated disorders.

What methodological improvements are needed to advance CBG00907 research?

Advancing CBG00907 research requires several methodological improvements:

  • Enhanced Protein Production and Purification:

    • Optimization of expression systems specifically for transmembrane proteins

    • Development of detergent-free systems using nanodiscs or amphipols

    • Scalable production methods for structural and functional studies

    • Standardization of quality control metrics for protein preparations

  • Improved Experimental Design:

    • Wider implementation of randomization in experimental procedures to reduce bias

    • Blinding of researchers when conducting subjective assessments

    • Appropriate use of factorial experimental designs to maximize information from each experiment

    • Pre-registration of study designs and analysis plans to enhance reproducibility

  • Advanced Imaging Technologies:

    • Super-resolution microscopy adaptations for transmembrane protein visualization

    • Live-cell imaging approaches to monitor dynamics in native environments

    • Correlative light and electron microscopy to link function with ultrastructure

  • Genetic Model Systems:

    • Development of C. briggsae as a robust genetic model specifically for CBG00907 studies

    • Creation of conditional and tissue-specific expression systems

    • Genome-wide interaction screens to identify functional partners

  • Data Integration and Sharing:

    • Standardized reporting formats for experimental conditions and results

    • Public repositories for sharing raw data, protocols, and reagents

    • Computational frameworks for integrating diverse data types

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.