Recombinant Transmembrane protein 151 homolog (ZK1067.4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ZK1067.4; Transmembrane protein 151 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
ZK1067.4
Target Protein Sequence
MAGTVDAQEHVAKPRRPNIFRVLRRTGYGKCLVCSLLLILCFFYATFCHVKHEAYSGSQP LLIYQHGPCAQGYNFVPIVFGLMLYIVYLMECWHSRTKIINMKKVRVEDALDYITALRTS PPIVWWKSVCYHYTRKTRQVTRYRNGDAVSATQVYYERMNSHQAGSMFIYDTCGFRDISK SILEVEKFHVTRIRLSRSFVFANMQAATEFEQQRSRFFNDNETKDDYMEVREGMDLSDVG FVEEILAFNKPTPPWFLHPIVFWFFSIFVLSWPLRIYTEWRTAVLSFQVIKLFGTNYLSP NSVNYTGPLTRTSTMDTVELEALLRREQHFVVPSYSEVMLMQNTIANSNTNYPNIRCLDP VILPRPFVSTTNEHIVLRNYGATETDNSLSEPITATPRPLRVSRSMTFAAQGNLEESAEN LSCLENGSRANRAIPSSRRNLPLRSLSIGGISAWSNGYREIGNPDDSQLLIEPDEPPPPY EVALRMCAPLYERLRRSISSRLASISHSSSKDLKSLTLKSSSSNNNNNNSNNNNNDDPEH P
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_ZK1067.4

UniGene: Cel.8531

Protein Families
TMEM151 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the predicted membrane topology of TMEM151A and its C. elegans homolog ZK1067.4?

Recent structural studies using molecular dynamics simulations, immunocytochemistry, and electron microscopy have revealed that TMEM151A comprises a transmembrane domain with two membrane-spanning alpha helices connected by a short extracellular loop and an intramembrane helix-hinge-helix structure. Most of the protein is oriented toward the intracellular side of membranes with a large cytosolic domain featuring a combination of alpha-helix and beta-sheet structures, as well as the protein N- and C-termini . Based on sequence homology, the C. elegans homolog ZK1067.4 likely shares similar topological features, although species-specific variations may exist.

How does the membrane topology of TMEM151A affect experimental approaches to studying ZK1067.4?

The membrane topology of TMEM151A, characterized by two transmembrane alpha helices and a large cytosolic domain, necessitates specific experimental considerations when studying ZK1067.4. The primarily intracellular orientation of functional domains suggests that antibody-based detection methods should target cytosolic epitopes for optimal accessibility . When designing recombinant constructs, fusion tags should be positioned at either the N- or C-terminus, as both are located intracellularly, rather than within the short extracellular loop which might disrupt proper membrane insertion. Additionally, the helix-hinge-helix structure within the membrane requires careful consideration when selecting detergents for solubilization to maintain protein stability during purification.

What are the key sequence motifs in TMEM151A/ZK1067.4 that influence proper membrane insertion?

While specific sequence motifs for TMEM151A/ZK1067.4 are not explicitly detailed in the search results, research on bacterial outer membrane proteins has identified critical motifs required for proper membrane insertion that likely apply to eukaryotic transmembrane proteins as well. These include hydrophobic residue patterns following the Φxxxxx[Ω/Φ]x[Ω/Φ] motif (where Φ represents hydrophobic and Ω represents aromatic residues) in beta-strands . For alpha-helical transmembrane proteins like TMEM151A/ZK1067.4, equivalent signals include hydrophobic residue clusters within transmembrane helices and positively charged residues at the cytoplasmic interface that follow the "positive-inside rule." When designing expression constructs, preserving these motifs is essential for proper membrane targeting and integration.

Which expression system is most suitable for producing recombinant ZK1067.4?

The optimal expression system for recombinant ZK1067.4 depends on downstream applications and required protein yields. For structural studies, several systems merit consideration:

E. coli BL21(DE3)/pET System: Offers high yield but requires optimization to prevent saturation of membrane protein biogenesis machinery. Consider the following modifications:

  • Omitting IPTG induction has been shown to improve membrane protein yields by preventing saturation of the biogenesis machinery

  • Using the Lemo21(DE3) strain which contains the pLemo plasmid encoding T7 lysozyme under rhamnose-inducible control, allowing fine-tuning of expression intensity

  • Employing the pReX (Regulated eXpression) plasmid system which combines elements from pLemo and pET vectors to facilitate co-expression with chaperones

Eukaryotic Systems: May provide more native-like post-translational modifications:

  • Insect cells (Sf9/Hi5) with baculovirus expression systems

  • Mammalian cells (HEK293/CHO) for studies requiring mammalian-specific modifications

For functional studies of ZK1067.4, C. elegans expression systems may better preserve protein-protein interactions specific to the nematode cellular environment.

How can fusion tags improve the expression and purification of recombinant ZK1067.4?

Fusion tags can significantly enhance expression, solubility, and purification efficiency of transmembrane proteins like ZK1067.4. Key strategies include:

Fusion TagPrimary BenefitsConsiderations for ZK1067.4
GFPEnables rapid screening via FSEC; monitors expression level and monodispersity without purificationC-terminal fusion preferred as both N- and C-termini are intracellular
His6/His10Facilitates purification via IMAC; compact size minimizes interferencePosition at protein termini; include TEV cleavage site for tag removal
MBPEnhances solubility; potential chaperone-like effectLarge tag may require optimization when used with membrane proteins
SUMOImproves expression and solubility; native-like cleavageEffective for preventing aggregation during expression

For structural studies, tags like T4 lysozyme or BRIL might be inserted into intracellular loops to enhance crystallization without disrupting membrane topology . When implementing fusion strategies, careful consideration should be given to tag placement to avoid disrupting critical transmembrane regions identified in the topology studies of TMEM151A .

What are effective methods to screen for optimal ZK1067.4 expression constructs?

To efficiently identify optimal expression constructs for ZK1067.4, implement a systematic screening approach:

  • Fluorescence-detection size-exclusion chromatography (FSEC): Fuse GFP to ZK1067.4 C-terminus to simultaneously assess expression levels and sample monodispersity without full purification . This allows rapid evaluation of multiple constructs with minimal sample preparation.

  • Terminal truncation series: Generate a library of N- and C-terminal truncations based on the predicted topology of ZK1067.4, preserving the core transmembrane helices while systematically removing potentially disordered regions that might hinder expression or subsequent structural studies.

  • Expression host matrix: Test expression across multiple systems in parallel:

    • E. coli strains (BL21(DE3), C41/C43, Lemo21(DE3))

    • Yeast (P. pastoris)

    • Insect cell lines

  • Induction condition screening: For E. coli expression, test:

    • IPTG-free expression which has shown improved yields for membrane proteins

    • Variable rhamnose concentrations when using the rhaBAD promoter system to fine-tune expression rates

  • Detergent screening: Early assessment of protein stability in different detergents using FSEC can inform both purification strategies and construct design.

This multi-parameter screening approach allows efficient identification of constructs with optimal expression, stability, and homogeneity before committing to large-scale production.

What detergent systems are most effective for solubilizing and purifying ZK1067.4?

The selection of appropriate detergents is critical for successful solubilization and purification of ZK1067.4. While specific detergent preferences for TMEM151A/ZK1067.4 are not mentioned in the search results, general principles for alpha-helical transmembrane proteins with two transmembrane segments apply:

  • Initial Screening Panel:

    • Mild detergents: DDM (n-Dodecyl-β-D-maltoside), LMNG (Lauryl maltose neopentyl glycol)

    • Intermediate detergents: DM (n-Decyl-β-D-maltoside), UDM (n-Undecyl-β-D-maltoside)

    • Harsh detergents: OG (n-Octyl-β-D-glucoside), LDAO (Lauryldimethylamine oxide)

  • Optimization Strategy:

    • Begin extraction with mild detergents (DDM/LMNG) to preserve native structure

    • Consider detergent exchange during purification, moving to more stabilizing systems

    • Evaluate protein stability and monodispersity in each detergent using SEC profiles

  • Alternative Solubilization Systems:

    • Styrene-maleic acid lipid particles (SMALPs) for native-like environment preservation

    • Amphipols for enhanced stability during structural studies

    • Nanodiscs for functional reconstitution

For a protein with the topology described for TMEM151A, with two transmembrane segments and a helix-hinge-helix intramembrane structure , particular attention should be paid to preserving the integrity of this unusual structural feature during solubilization and purification.

How can the purity and stability of ZK1067.4 preparations be assessed?

Comprehensive assessment of ZK1067.4 purity and stability requires multiple complementary approaches:

  • Purity Assessment:

    • SDS-PAGE: Standard method with Coomassie staining (>90% purity typically required for structural studies)

    • Western blot: Using tag-specific or protein-specific antibodies for identity confirmation

    • SEC: Evaluate monodispersity and absence of aggregates or degradation products

    • Mass spectrometry: Determine precise mass and identify potential post-translational modifications

  • Stability Assessment:

    • Thermal stability: CPM (7-Diethylamino-3-(4-maleimidophenyl)-4-methylcoumarin) fluorescence assay to monitor protein unfolding

    • Time-course stability: SEC analysis after storage at 4°C for defined periods

    • Freeze-thaw stability: Compare SEC profiles before and after freeze-thaw cycles

  • Functional Integrity:

    • Circular dichroism (CD): Verify secondary structure composition, particularly alpha-helical content expected from topology studies

    • Tryptophan fluorescence: Probe tertiary structure integrity

    • Binding assays for known interaction partners, if identified

For transmembrane proteins like ZK1067.4, maintaining sample homogeneity throughout purification is particularly challenging but essential for downstream structural and functional studies. Regular quality control using SEC-MALS (size exclusion chromatography with multi-angle light scattering) can provide valuable information about the oligomeric state and detergent binding.

What reconstitution methods are appropriate for functional studies of ZK1067.4?

For functional studies of ZK1067.4, reconstitution into membrane-mimetic systems that restore a lipid bilayer environment is essential. Several methods can be employed:

  • Proteoliposome Reconstitution:

    • Method: Detergent removal via dialysis, Bio-Beads, or cyclodextrin

    • Advantages: Provides controllable lipid composition; suitable for transport assays

    • Considerations: Optimize protein:lipid ratio and reconstitution efficiency; verify orientation

  • Nanodisc Incorporation:

    • Method: Assembly with membrane scaffold proteins (MSPs) and defined lipids

    • Advantages: Provides a native-like membrane environment with controlled size; accessible from both sides

    • Applications: Ideal for interaction studies with soluble partners and single-molecule techniques

  • GUV (Giant Unilamellar Vesicle) Formation:

    • Method: Electroformation or gentle hydration of proteoliposomes

    • Advantages: Allows microscopy-based functional assays; suitable for studying protein dynamics

    • Applications: Electrophysiology, fluorescence microscopy, membrane deformation studies

Given that TMEM151A/ZK1067.4 has been implicated in neurological functions (paroxysmal kinesigenic dyskinesia) , electrophysiological characterization in proteoliposomes or cell-based assays may be particularly relevant for functional studies.

How do molecular dynamics simulations complement experimental approaches in studying ZK1067.4 structure?

Molecular dynamics (MD) simulations provide powerful complementary insights to experimental structural studies of transmembrane proteins like ZK1067.4:

  • Validation and Refinement:

    • MD simulations have been successfully used to validate AlphaFold models of TMEM151A, confirming the predicted topology with two membrane-spanning alpha helices and the helix-hinge-helix intramembrane structure

    • For ZK1067.4, similar validation approaches can assess model stability within a lipid bilayer environment

  • Dynamic Behavior Analysis:

    • While experimental methods provide static snapshots, MD reveals conformational dynamics

    • Simulations can identify flexible regions that might hinder crystallization

    • Analysis of water/ion pathways can suggest potential transport functions

  • Integration with Experimental Data:

    • Distance constraints from cross-linking or spectroscopic studies can be incorporated as restraints

    • Simulation-guided mutagenesis can identify residues critical for stability or function

    • Lipid-protein interactions observed in simulations can inform optimal lipid compositions for functional studies

  • Methodology Considerations:

    • All-atom simulations in explicit membranes provide detailed interactions but are computationally expensive

    • Coarse-grained simulations allow longer timescales to observe larger conformational changes

    • Enhanced sampling techniques can accelerate exploration of conformational space

For ZK1067.4, MD simulations would be particularly valuable for understanding the functional implications of the unusual helix-hinge-helix structure observed in its human homolog , and how this structure might influence membrane deformation or protein-protein interactions.

What are the key considerations for crystallization trials of ZK1067.4?

Crystallization of transmembrane proteins like ZK1067.4 presents unique challenges requiring specialized approaches:

  • Construct Optimization:

    • Based on the predicted topology of TMEM151A/ZK1067.4 , generate constructs that:

      • Remove flexible N- and C-terminal regions while preserving core transmembrane domains

      • Consider fusion partners (T4 lysozyme, BRIL) inserted into intracellular loops to increase soluble surface area

      • Maintain the integrity of the helix-hinge-helix intramembrane structure

  • Detergent Selection:

    • Screen detergents systematically, starting with those producing monodisperse SEC profiles

    • Consider shorter-chain detergents (NG, OG) which typically form smaller micelles advantageous for crystal contacts

    • Evaluate detergent mixtures which can optimize micelle size and protein stability

  • Crystallization Methods:

    • Lipidic cubic phase (LCP) crystallization: Particularly successful for alpha-helical membrane proteins

    • Vapor diffusion: Traditional approach using detergent-solubilized protein

    • Bicelle crystallization: Intermediate between detergent and lipidic systems

  • Additive Strategies:

    • Lipids: Include native lipids identified through lipidomics to enhance stability

    • Ligands/inhibitors: If available, can stabilize specific conformations

    • Antibody fragments/nanobodies: Increase polar surface area and provide crystal contacts

  • Quality Assessment:

    • Implement pre-crystallization tests (PCT) to optimize protein concentration

    • Use UV-SONICC (second-order nonlinear imaging of chiral crystals) to identify potential microcrystals

    • Consider serial crystallography approaches for microcrystals

Given the relatively small size of ZK1067.4 with only two predicted transmembrane helices , crystallization may be particularly challenging without additional stabilizing elements like antibody fragments or fusion partners to provide crystal contacts.

How can cryo-EM be applied to structural studies of ZK1067.4 despite its small size?

  • Megabody/Scaffold Approaches:

    • Fusion to scaffold proteins: Attach ZK1067.4 to larger scaffold proteins like apoferritin

    • Antibody complexes: Use multiple antibody fragments or nanobodies to increase molecular weight

    • Symmetric assemblies: Engineer constructs promoting higher-order oligomerization

  • Membrane Mimetic Optimization:

    • Nanodiscs with engineered MSPs (membrane scaffold proteins): Provide additional mass and defined particle size

    • Amphipol-stabilized complexes: Enhance contrast compared to detergent micelles

    • Saposin-lipid nanoparticles: Offer smaller particle size than conventional nanodiscs

  • Data Collection Strategies:

    • Volta phase plates: Enhance contrast for small particles

    • Energy filters: Improve signal-to-noise ratio

    • Higher magnification: Increase sampling detail

    • Motion correction: Optimize frame alignment for smaller particles

  • Analysis Approaches:

    • Reference-based particle picking: Use 2D projections from molecular models

    • Local resolution enhancement: Focus refinement on the protein region

    • Signal subtraction: Remove density from scaffold or membrane mimetic during processing

Recent advances have pushed the lower size limit for cryo-EM, with structures of proteins as small as ~50 kDa becoming feasible. For ZK1067.4, combining multiple approaches (e.g., symmetric oligomerization and larger membrane mimetics) would likely yield the best results.

What experimental approaches can determine if ZK1067.4 functions similarly to human TMEM151A in neurological processes?

Given that TMEM151A has been identified as a causative gene for paroxysmal kinesigenic dyskinesia , determining whether ZK1067.4 shares similar neurological functions requires multi-faceted approaches:

  • C. elegans In Vivo Analysis:

    • CRISPR/Cas9 knockout or knockdown studies to evaluate behavioral phenotypes related to movement disorders

    • GFP-tagging for subcellular localization in neurons

    • Rescue experiments: Test if human TMEM151A can complement ZK1067.4 mutant phenotypes

    • Electrophysiological recordings from neurons in ZK1067.4 mutants vs. wild-type

  • Comparative Protein Interaction Studies:

    • Immunoprecipitation coupled with mass spectrometry to identify interacting partners

    • Yeast two-hybrid or BioID proximity labeling to map protein interaction networks

    • Compare interactomes between human TMEM151A and C. elegans ZK1067.4 to identify conserved pathways

  • Functional Conservation Assessment:

    • Heterologous expression: Express ZK1067.4 in mammalian neurons and assess localization/function

    • Domain swapping: Create chimeric proteins between human and C. elegans homologs to map functional domains

    • Site-directed mutagenesis targeting residues known to cause disease in human TMEM151A

  • Electrophysiological Characterization:

    • Patch-clamp analysis in expression systems to determine if ZK1067.4 forms or modulates ion channels

    • Calcium imaging to assess potential roles in neuronal signaling

    • Membrane potential measurements to detect changes in neuronal excitability

The unusual membrane topology of TMEM151A, with its helix-hinge-helix intramembrane structure , may provide clues about its function, potentially involving membrane deformation, protein scaffolding, or sensory detection.

How can ZK1067.4 mutants be designed to model human TMEM151A-associated disease mutations?

To effectively model human TMEM151A-associated disease mutations in C. elegans ZK1067.4, a systematic approach combining bioinformatics and experimental validation is recommended:

  • Sequence Alignment and Conservation Analysis:

    • Perform multiple sequence alignment between human TMEM151A and C. elegans ZK1067.4

    • Identify conserved residues, particularly in transmembrane domains and the helix-hinge-helix structure

    • Map known human disease mutations onto the ZK1067.4 sequence based on conservation

  • Structural Modeling and Validation:

    • Generate homology models of ZK1067.4 based on the validated AlphaFold model of TMEM151A

    • Use molecular dynamics simulations to assess the impact of mutations on protein stability

    • Categorize mutations based on predicted effects: destabilizing, interface-disrupting, or functional surface

  • Mutant Generation Strategies:

    • CRISPR/Cas9 genome editing for precise modification of the endogenous ZK1067.4 gene

    • Use the following mutation types:

      • Direct orthologs: Introduce identical amino acid changes at conserved positions

      • Functional analogs: Modify residues with similar roles even if not identical

      • Domain-specific mutations: Target specific structural elements like the transmembrane helices

  • Phenotypic Characterization Matrix:

Mutation TypeBehavioral AnalysisSubcellular LocalizationProtein StabilityElectrophysiological Properties
Transmembrane domain mutationsMovement analysis, seizure susceptibilityMembrane vs. ER retentionDetergent extraction efficiencyChannel conductance/modulation
Cytosolic domain mutationsSubtler behavioral effectsInteraction partner bindingTotal expression levelsIndirect effects on excitability
Intramembrane helix-hinge-helix mutationsSpecific stress responsesMembrane microdomain localizationConformational stabilityPotential mechanosensory functions

By systematically characterizing these mutants across multiple parameters, researchers can establish ZK1067.4 as a valid model for studying the molecular mechanisms of TMEM151A-associated paroxysmal kinesigenic dyskinesia .

What techniques can determine if ZK1067.4 interacts with Argonaute proteins similar to other C. elegans transmembrane proteins?

To investigate potential interactions between ZK1067.4 and Argonaute proteins in C. elegans, as has been observed for some other transmembrane proteins , the following methodological approaches are recommended:

  • Co-immunoprecipitation (Co-IP) Analysis:

    • Generate tagged versions of ZK1067.4 (preserving the transmembrane topology )

    • Perform reciprocal Co-IPs with various C. elegans Argonaute proteins

    • Include appropriate controls including ZNFX-1, which is known to interact with multiple Argonaute systems

    • Use crosslinking approaches to capture transient interactions

  • Proximity Labeling Approaches:

    • BioID: Fuse a biotin ligase to ZK1067.4 or specific Argonaute proteins

    • APEX2: Alternative enzyme-based proximity labeling with shorter labeling radius

    • TurboID: Enhanced biotin ligase for faster labeling kinetics

    • These methods can identify even transient or weak interactions in the native cellular environment

  • Functional Genetic Analysis:

    • Generate ZK1067.4 mutants and assess effects on small RNA pathways

    • Perform RNA sequencing to identify changes in Argonaute-associated small RNAs

    • Conduct genetic epistasis experiments with Argonaute mutants

    • Evaluate transgenerational inheritance effects, which are known to involve Argonaute systems

  • Localization Studies:

    • Co-localization analysis of fluorescently tagged ZK1067.4 and Argonaute proteins

    • Investigate perinuclear nuage localization, which is characteristic of ZNFX-1 and some Argonaute proteins

    • Implement super-resolution microscopy to detect nano-scale associations

    • Perform FRET (Förster Resonance Energy Transfer) to detect direct interactions

Given the primarily intracellular orientation of TMEM151A with both N- and C-termini in the cytosol , if this topology is conserved in ZK1067.4, these cytosolic domains would be the most likely interaction sites with Argonaute proteins, which function primarily in RNA processing pathways.

How can expression yields of ZK1067.4 be optimized when conventional methods produce insufficient protein?

When conventional expression systems yield insufficient amounts of ZK1067.4, several advanced strategies can be implemented:

  • E. coli Expression Optimization:

    • Implement the pReX (Regulated eXpression) plasmid system which combines elements from pLemo and pET vectors to allow fine-tuning of expression rate

    • Use rhamnose-inducible promoters in rhamnose metabolism-deficient strains, which allows true tuning of production rate through varying rhamnose concentration

    • Co-express with chaperones specific for membrane proteins (e.g., FtsY, YidC)

    • Consider BL21T7 strains with deleted lysis-related genes from the λDE3 prophage for enhanced stability

  • Alternative Expression Systems:

    • Cell-free membrane protein expression systems:

      • Extract supplemented with lipids or nanodiscs for direct incorporation

      • Continuous exchange formats to remove inhibitory byproducts

    • Methylotrophic yeasts (Pichia pastoris) with inducible promoters

    • Tetracycline-inducible mammalian expression systems with stable cell lines

  • Fusion Partner Strategies:

    • Test multiple fusion partners in parallel:

      • Mistic: Specifically enhances membrane protein expression

      • MBP: Provides solubility enhancement

      • SUMO: Improves folding and stability

    • Implement dual fusion tags (N- and C-terminal) with orthogonal purification properties

  • Production Process Optimization:

    • High-density fermentation with controlled feeding strategies

    • Reduced temperature cultivation (16-20°C) to slow folding and prevent aggregation

    • Test alternative media formulations including supplementation with specific lipids

    • Implement optimal induction at specific growth phases based on real-time monitoring

For membrane proteins like ZK1067.4 with complex topology , the key parameter is often not maximum expression level but rather the proportion of correctly folded and membrane-inserted protein. Strategies that enhance folding quality even at lower expression levels may ultimately yield more functional protein.

What strategies can resolve aggregation issues during purification of recombinant ZK1067.4?

Aggregation during purification is a common challenge for transmembrane proteins like ZK1067.4. Implementing the following strategies can help maintain protein solubility and homogeneity:

  • Solubilization Optimization:

    • Systematic detergent screening beyond standard options:

      • Newer detergents like GDN (glyco-diosgenin) or LMNG (lauryl maltose neopentyl glycol)

      • Detergent mixtures (e.g., DDM/CHS) to stabilize specific conformations

      • Evaluate native lipid supplementation during solubilization

    • Optimize parameters:

      • Temperature (4°C vs. room temperature)

      • Duration (1 hour vs. overnight)

      • Protein:detergent ratio variations

  • Buffer Engineering:

    • Stability screen matrix:

      • pH range (typically 6.0-8.5)

      • Ionic strength (100-500 mM salt)

      • Specific ions (Na+, K+, Ca2+, Mg2+)

    • Additives for enhanced stability:

      • Glycerol (10-20%)

      • Specific lipids identified through lipidomics

      • Osmolytes (sucrose, trehalose)

      • Cholesterol hemisuccinate

  • Chromatography Approaches:

    • Implement mild purification conditions:

      • Lower flow rates during chromatography

      • Temperature control throughout purification

      • Minimize concentration steps or use controlled gradual concentration

    • Consider alternative purification strategies:

      • Affinity purification directly from solubilized membranes without clarification

      • SEC as first purification step to separate aggregates

      • Ion exchange at carefully optimized pH to avoid aggregation-prone isoelectric point

  • Conformation Stabilization:

    • If ligands are known, include throughout purification

    • Consider nanobodies or antibody fragments that recognize folded conformations

    • Evaluate detergent-free systems like styrene-maleic acid lipid particles (SMALPs)

For a protein with the unique topology of TMEM151A/ZK1067.4, with its helix-hinge-helix intramembrane structure , preserving these unusual structural elements during purification is likely critical for maintaining native conformation and preventing aggregation.

How can contradicting experimental results about ZK1067.4 structure or function be reconciled?

When faced with contradicting experimental results regarding ZK1067.4 structure or function, a systematic approach to reconciliation is essential:

  • Methodological Cross-Validation:

    • Compare results across complementary techniques:

      • Structural information: Compare computational predictions, biochemical topology mapping, and direct structural determination

      • Functional data: Integrate in vitro biochemical assays with in vivo phenotypic studies

    • Evaluate methodological limitations specific to membrane proteins:

      • Detergent effects on structure and function

      • Differences between heterologous expression systems

      • Impact of tags on protein behavior

  • Condition-Dependent Hypothesis Testing:

    • Systematically vary experimental conditions to identify parameters causing divergent results:

      • Lipid environment dependencies

      • Post-translational modification status

      • Interaction partner presence/absence

      • Conformational state variations

    • Design experiments to specifically test whether contradictions represent:

      • Different functional states of the same protein

      • Technical artifacts of specific methods

      • Species-specific differences between homologs

  • Integrated Data Analysis Framework:

Data SourceWeight of EvidencePotential ArtifactsValidation Approach
Structural predictions (AlphaFold)Medium-high for fold, lower for dynamicsTemplate bias, dynamics limitationsMD simulation validation , experimental cross-validation
Biochemical assaysHigh for direct interactionsDetergent effects, non-native conditionsMultiple detergent testing, in vivo validation
Genetic studiesHigh for physiological relevanceCompensatory mechanisms, indirect effectsDomain-specific mutants, rescue experiments
Heterologous expressionVariableExpression artifacts, missing partnersCompare across systems, add potential partners
  • Collaboration and Independent Verification:

    • Engage multiple laboratories with different expertise

    • Standardize key reagents and protocols

    • Implement blinded analysis of critical experiments

    • Consider publishing contradictory results together with joint discussion

For complex transmembrane proteins like ZK1067.4, reconciling contradictions often leads to deeper mechanistic understanding, as proteins may adopt multiple conformations or functional states depending on cellular context or experimental conditions.

How might AI-based structural prediction tools like AlphaFold impact research on ZK1067.4?

AI-based structural prediction tools like AlphaFold represent a transformative approach for studying proteins like ZK1067.4:

For ZK1067.4 specifically, AlphaFold models can help determine whether the unusual helix-hinge-helix intramembrane structure identified in TMEM151A is conserved, providing insights into evolutionary conservation of this structural feature and its potential functional significance.

What novel methodologies could overcome current barriers in studying ZK1067.4 interactions with other proteins?

Several cutting-edge approaches can address the challenges in studying membrane protein interactions involving ZK1067.4:

  • Advanced Proximity Labeling Technologies:

    • Split TurboID: Detect specific protein-protein interactions through proximity biotin labeling

    • APEX2-APEX2 interaction-dependent labeling: Enhanced specificity for direct interactions

    • Photocrosslinkable amino acid incorporation: Site-specific capture of transient interactions

    • These methods are particularly valuable for proteins with the predominantly intracellular orientation observed in TMEM151A

  • Single-Molecule Approaches:

    • Single-molecule FRET (smFRET): Detect conformational changes upon binding

    • Total internal reflection fluorescence (TIRF) microscopy: Monitor individual binding events

    • Nanodiscs combined with atomic force microscopy: Visualize interactions in membrane context

    • These techniques can detect rare events or heterogeneous populations often missed in bulk measurements

  • Mass Spectrometry Innovations:

    • Crosslinking mass spectrometry (XL-MS) with MS-cleavable crosslinkers

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

    • Native mass spectrometry of membrane protein complexes

    • These approaches provide structural details of interactions without requiring crystallization

  • In-cell Detection Systems:

    • Split fluorescent proteins optimized for membrane protein topology

    • NanoBiT complementation assays with membrane-optimized components

    • Fluorescence fluctuation spectroscopy in living cells

    • These methods assess interactions in their native cellular environment

For proteins with the unusual topology of TMEM151A/ZK1067.4, with two transmembrane segments and a helix-hinge-helix intramembrane structure , these advanced methods offer the sensitivity and specificity needed to identify interaction partners that may be essential for understanding their function in normal physiology and disease states.

How might ZK1067.4 research contribute to understanding broader principles of membrane protein evolution?

Research on ZK1067.4 can provide valuable insights into fundamental principles of membrane protein evolution:

  • Structural Conservation Across Distant Species:

    • The unusual membrane topology of TMEM151A with two transmembrane alpha helices and a helix-hinge-helix intramembrane structure represents a distinctive architectural feature

    • Comparing this topology between human TMEM151A and C. elegans ZK1067.4 can reveal:

      • Evolutionary conservation of unique structural elements

      • Species-specific adaptations in membrane-embedded regions

      • Differential conservation between transmembrane segments versus cytosolic domains

  • Functional Divergence and Conservation:

    • TMEM151A's association with paroxysmal kinesigenic dyskinesia suggests neurological functions

    • Comparative analysis between human and C. elegans homologs can illuminate:

      • Core conserved functions across metazoan evolution

      • Lineage-specific functional specializations

      • Evolutionary plasticity of membrane protein functions

  • Protein Interaction Network Evolution:

    • C. elegans transmembrane proteins can interact with epigenetic machinery like Argonaute proteins

    • Investigating whether ZK1067.4 maintains similar interactions can reveal:

      • Conservation of protein-protein interaction interfaces

      • Evolution of membrane protein roles in cellular signaling

      • Species-specific rewiring of interaction networks

  • Disease Mechanism Insights:

    • Comparing disease-causing mutations in human TMEM151A with equivalent positions in ZK1067.4

    • Evaluating whether homologous mutations cause similar phenotypes in C. elegans

    • This approach can distinguish between:

      • Ancient fundamental functions disrupted in disease

      • Recently evolved species-specific functions

Understanding these evolutionary principles through comparative studies of ZK1067.4 and TMEM151A contributes to broader knowledge about how membrane proteins adapt to different cellular environments while maintaining core structural and functional properties, potentially revealing conserved mechanisms relevant to human disease.

What are the most promising future research directions for ZK1067.4 based on current knowledge?

Based on the current understanding of TMEM151A and its C. elegans homolog ZK1067.4, several high-priority research directions emerge:

  • Structure-Function Relationship Exploration:

    • Validate and refine the predicted membrane topology with two transmembrane segments and the unusual helix-hinge-helix intramembrane structure specifically in ZK1067.4

    • Determine whether this distinctive architecture serves mechanical, signaling, or scaffolding functions

    • Investigate structure-based mechanisms linking mutations to neurological phenotypes

  • Evolutionary Conservation Analysis:

    • Perform comprehensive comparative studies between human TMEM151A and C. elegans ZK1067.4

    • Map the conservation of critical structural and functional domains

    • Determine whether disease-associated mutations affect evolutionarily conserved functions

  • Molecular Pathway Integration:

    • Establish whether ZK1067.4 interacts with epigenetic machinery similar to other C. elegans transmembrane proteins

    • Determine if ZK1067.4 associates with neuronal signaling complexes related to movement disorders

    • Map the complete protein interaction network in both C. elegans and comparative mammalian systems

  • Therapeutic Target Validation:

    • Develop C. elegans models expressing ZK1067.4 variants mimicking human disease mutations

    • Establish high-throughput screening platforms using these models

    • Evaluate pharmacological approaches targeting disease mechanisms

These complementary research directions build upon the foundation of recent structural insights into TMEM151A while leveraging the experimental advantages of C. elegans as a model system to accelerate understanding of fundamental biology and disease mechanisms.

How should researchers prioritize experimental approaches when studying ZK1067.4 with limited resources?

When investigating ZK1067.4 with resource constraints, strategic prioritization of experimental approaches maximizes scientific impact:

  • High-Priority Initial Investments:

    • Validated expression constructs: Develop reliable expression systems for recombinant ZK1067.4 using the methodologies that proved successful for membrane proteins in E. coli or alternative systems

    • Basic topology confirmation: Verify whether ZK1067.4 shares the membrane topology described for TMEM151A using accessible biochemical approaches

    • C. elegans knockout/knockdown models: Generate basic genetic tools to assess ZK1067.4 function in vivo

  • Resource-Efficient Experimental Pipeline:

Experimental ApproachResource RequirementScientific ImpactPriority Level
AlphaFold structural modeling with MD validationLow-MediumHighFirst tier
Basic phenotypic characterization of C. elegans mutantsLow-MediumHighFirst tier
Fluorescent tagging for localization studiesLow-MediumMedium-HighFirst tier
GFP-fusion expression screening in E. coliMediumMedium-HighSecond tier
Co-immunoprecipitation with candidate interactorsMediumMedium-HighSecond tier
Advanced structural studies (cryo-EM, XRD)HighHigh (but dependent on prior work)Third tier
  • Strategic Collaboration Approach:

    • Partner with structural biology labs for resource-intensive structural studies

    • Establish collaborations with C. elegans genetics groups for in vivo studies

    • Share validated reagents (constructs, antibodies, strains) to maximize community resources

  • Phased Research Plan:

    • Phase 1: Foundational tools and validation (6-12 months)

    • Phase 2: Functional characterization and interaction studies (12-24 months)

    • Phase 3: Advanced structural studies based on results from earlier phases (24+ months)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.