Recombinant Transmembrane protein 33 homolog (Y37D8A.17)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Transmembrane Protein 33 Homolog (Y37D8A.17)

Recombinant Transmembrane Protein 33 Homolog (Y37D8A.17) is a synthetic protein derived from Caenorhabditis elegans (nematode), sharing structural and functional homology with mammalian TMEM33 (transmembrane protein 33). This recombinant variant is engineered for research applications, with modifications such as His-tag fusion for purification and expression optimization in bacterial systems (e.g., E. coli) .

Experimental Utility

  • ELISA/Western Blot: Used to detect Y37D8A.17 expression in C. elegans lysates or recombinant systems .

  • Subcellular Localization: Immunofluorescence studies could map its distribution in nematode cells.

  • Interaction Studies: Co-IP assays to identify binding partners (e.g., PERK homologs in C. elegans).

Comparative Analysis with TMEM33

FeatureTMEM33 (Human)Y37D8A.17 (C. elegans)
Transmembrane Domains3 helices (32–52, 101–121, 156–176 aa)Predicted based on sequence homology
Stress InducibilityUpregulated under ER stressHypothetical (unverified)
Cancer AssociationPrognostic marker in cervical cancerNot documented
Binding PartnersPERK, IRE1αUnidentified

Challenges and Future Directions

  • Functional Validation: Direct experimental evidence for Y37D8A.17’s role in UPR or apoptosis is lacking.

  • Species-Specific Pathways: C. elegans models may reveal evolutionary conservation/divergence of TMEM33/Y37D8A.17 functions.

  • Therapeutic Potential: Further studies are needed to assess its relevance to disease modeling or drug discovery.

References and Diverse Sources

  1. Product Specifications: MyBioSource, Creative BioMart, Colorectal Research .

  2. Functional Homology: PMC articles on TMEM33’s role in ER stress and cancer .

  3. Structural Insights: UniProt annotation (Q9XWV0) and sequence alignment data .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested. Please contact us in advance for dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
npp-25; Y37D8A.17; Transmembrane protein 33 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
Y37D8A.17
Target Protein Sequence
MVEIVEEPDDHQSSSTGAGSSGSSSAPPPPPPPAYSSISQYVSANTMECVLFAARVLTVF FALNYMIPFIGLVPAHSAYYKIFAASAATFALRLHTRIQGQFALNAQFIQRLIIEDSFHY LVYSVVFLMAAPVSMAALPVTIYAALHACTFMTKILRETGHTSSIIPKLEQFTAHQTQNA LGIIACSEIFLVPLLVSLIFSGKGSLLLPFAYYRFLSLRYASRRNPSTRQAFAQMRGSLQ NVAMSSSCPRPISSLIYRAIDFISARAPPVM
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_Y37D8A.17

STRING: 6239.Y37D8A.17

UniGene: Cel.9867

Protein Families
PER33/POM33 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane protein 33 homolog (Y37D8A.17)?

Transmembrane protein 33 homolog (Y37D8A.17) is a three-pass transmembrane domain protein conserved throughout evolution, with the Caenorhabditis elegans homolog being designated as Y37D8A.17. This protein is primarily localized to the nuclear envelope and endoplasmic reticulum (ER) and serves as a regulator of the tubular ER network by suppressing the membrane-shaping activity of reticulons. The full-length protein in C. elegans consists of 271 amino acids and is commonly studied with His-tag modifications for recombinant expression and purification purposes . Research indicates that TMEM33 functions at the intersection of ER stress response pathways and calcium regulation, making it a protein of significant interest in both basic cellular biology and disease research contexts.

What expression systems are available for recombinant Y37D8A.17 production?

Recombinant Y37D8A.17 can be expressed in several systems, with E. coli being the most documented for the C. elegans variant. Commercial sources offer His-tagged full-length protein (1-271) expressed in E. coli systems . For researchers pursuing their own expression, it's important to note that membrane proteins require special considerations. While bacterial expression provides high yields, eukaryotic systems may offer better post-translational modifications. When designing expression constructs, researchers should consider that improper folding of transmembrane domains can occur in heterologous systems. Codon optimization for the expression host is recommended, particularly when expressing the protein in yeast or insect cell systems that may provide a more native-like membrane environment for proper folding of this three-pass transmembrane protein.

How is TMEM33 conserved across different model organisms?

TMEM33 is highly conserved across eukaryotic species, with homologs identified in organisms ranging from yeast to humans. The protein's three-transmembrane domain structure and ER localization remain consistent features across species . Available recombinant protein options include those from Dictyostelium discoideum and Caenorhabditis elegans, highlighting the evolutionary conservation of this protein . The high degree of conservation suggests fundamental cellular functions, which is supported by research demonstrating its role in ER membrane organization across diverse organisms. Despite conservation in structure, species-specific variations in TMEM33 function have been observed. For example, while the human TMEM33 is implicated in cancer progression, the zebrafish homolog has been characterized for its role in angiogenesis through regulation of Vegfa-mediated Ca²⁺ oscillations .

How does TMEM33 interact with the unfolded protein response (UPR) pathway?

TMEM33 functions as a novel stress-inducible endoplasmic reticulum transmembrane protein that interacts directly with key UPR pathway components. Research has shown that TMEM33 is a binding partner of PERK, one of the three main ER stress sensors. Upon stress induction, TMEM33 expression increases, followed by enhanced activation of both the PERK-eIF2α-ATF4 and IRE1-XBP1 axes of the UPR signaling cascade . Methodologically, this interaction has been demonstrated through immunoprecipitation assays, while the functional consequences have been assessed through overexpression studies showing increased levels of phosphorylated eIF2α and IRE1α along with their downstream effectors ATF4-CHOP and XBP1-S, respectively . To investigate these interactions in your own research, co-immunoprecipitation followed by western blotting is recommended, using antibodies against both TMEM33 and UPR components. Proximity ligation assays can provide additional spatial information about these interactions in situ.

What is TMEM33's role in calcium homeostasis regulation?

TMEM33 regulates intracellular calcium homeostasis in a polycystin-2 (PC2)-dependent manner. Studies have shown that this regulation affects downstream processes including cathepsins translocation and sensitization to apoptosis in renal tubular epithelial cells . In zebrafish models, TMEM33 is required for Vegfa-mediated Ca²⁺ oscillations that promote angiogenesis during embryonic development . To investigate TMEM33's role in calcium signaling, researchers should employ calcium imaging techniques using fluorescent indicators such as Fura-2 or genetically encoded calcium indicators (GECIs). Patch-clamp electrophysiology can provide direct measurements of calcium channel activity in the presence or absence of TMEM33. Additionally, CRISPR-Cas9 knockout models followed by calcium flux assays will help establish causality between TMEM33 expression and calcium regulation.

What protein interactions are critical for TMEM33 function?

TMEM33 engages in several critical protein interactions that determine its cellular functions. Research has identified interactions with:

  • PERK: Direct binding confirmed through co-immunoprecipitation studies, influencing UPR signaling

  • Polycystin-2 (PC2): Functional interaction affecting calcium homeostasis

  • Reticulons: TMEM33 suppresses their membrane-shaping activity, influencing ER morphology

  • PKM2: TMEM33 functions as a downstream effector in regulating SREBP activation and lipid metabolism

Additionally, TMEM33 is reported to co-assemble with TMEM43, TMED1, and ENDOD1 to form a complex that modulates innate immune signaling through the cGAS-STING pathway . To investigate these interactions, researchers should employ a combination of techniques including co-immunoprecipitation, proximity ligation assays, FRET/BRET analyses, and yeast two-hybrid screening to identify novel interacting partners.

What are the recommended methods for studying TMEM33 subcellular localization?

Subcellular fractionation followed by western blotting provides biochemical confirmation of localization studies, while electron microscopy with immunogold labeling offers higher resolution visualization of the precise membrane domains where TMEM33 resides. For C. elegans Y37D8A.17, tissue-specific expression patterns can be determined using transgenic approaches with tissue-specific promoters driving reporter expression. When designing experiments, consider that stress conditions may alter TMEM33 localization, necessitating comparative studies under normal and stress conditions.

What knockout or knockdown strategies are most effective for studying TMEM33 function?

Multiple gene modulation approaches have been validated for TMEM33 functional studies:

ApproachAdvantagesLimitationsRecommended Application
siRNA/shRNARapid implementation, tunable knockdownIncomplete silencing, off-target effectsInitial screening, transient studies
CRISPR-Cas9 knockoutComplete protein elimination, permanent modificationPotential compensatory mechanisms, lethal if essentialDefinitive functional studies
Conditional knockoutsTissue-specific or inducible deletionMore complex design and validationStudies in developmental contexts
Dominant negative constructsTargets specific protein domains/functionsPotential off-target effects on related proteinsMechanism-focused investigations

For C. elegans Y37D8A.17 studies, RNAi feeding is particularly effective and straightforward . When designing knockdown experiments, include rescue experiments with wild-type protein to confirm specificity. In cancer cell models, TMEM33 knockdown has been demonstrated to inhibit cell proliferation and decrease expression of tumorigenesis-related genes including RNF4, OCIAD1, TMED5, DHX15, MED28, and LETM1 .

How can researchers effectively tag TMEM33 without disrupting function?

Effective tagging of TMEM33 requires careful consideration of its membrane topology and functional domains. Based on its three-pass transmembrane structure, optimal tagging strategies include:

  • C-terminal tagging is generally preferred, as the C-terminus is predicted to face the cytoplasm in most models. His-tags have been successfully implemented in recombinant expressions .

  • For fluorescent protein fusions, monomeric variants (mEGFP, mCherry) with flexible linkers (GGGGS)₃ minimize interference with membrane insertion.

  • Internal epitope tags should be avoided within or adjacent to the transmembrane domains, which span approximately residues 54-74, 89-109, and 163-183 in human TMEM33.

  • Split-tag approaches, where complementary fragments of a reporter protein are attached to different termini, can provide information about protein topology while minimizing functional disruption.

Always validate tagged constructs by confirming correct localization and conducting functional assays to ensure the tag doesn't impair known TMEM33 activities such as regulation of calcium homeostasis or interactions with UPR components.

What is the significance of TMEM33 expression in cancer prognosis?

TMEM33 expression demonstrates significant prognostic value in several cancer types, most notably in cervical cancer. High expression of TMEM33 is associated with poor prognostic clinical characteristics and reduced survival metrics in cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC) patients . Analysis of TCGA and GEO datasets revealed that TMEM33 is upregulated in 24 of 33 cancer types compared to normal tissues, suggesting a broad role in tumorigenesis .

How does TMEM33 influence immune infiltration in tumor microenvironments?

TMEM33 expression demonstrates significant correlations with immune cell infiltration in tumor microenvironments, potentially contributing to its role in cancer progression. Research using single-sample Gene Set Enrichment Analysis (ssGSEA) has revealed that TMEM33 expression positively correlates with infiltration of T helper cells and Eosinophils in cervical cancer . Conversely, negative correlations were observed with several immune cell populations including:

Negatively Correlated Immune CellsCorrelation Significance
Th1 cellsSignificant
Regulatory T cells (Treg)Significant
Immature dendritic cells (iDC)Significant
Dendritic cells (DC)Significant
Cytotoxic cellsSignificant
B cellsSignificant
T cellsSignificant
CD56dim NK cellsSignificant
Plasmacytoid dendritic cells (pDC)Significant
Activated dendritic cells (aDC)Significant

These associations suggest that TMEM33 may influence the immunosuppressive tumor microenvironment, potentially by modulating innate immune signaling through pathways such as cGAS-STING . Researchers investigating this aspect should consider multispectral immunohistochemistry or flow cytometry approaches to directly quantify immune cell populations in relation to TMEM33 expression levels.

What molecular mechanisms underlie TMEM33's role in tumor progression?

TMEM33 appears to promote tumorigenesis through multiple interconnected molecular mechanisms. Knockdown experiments in cervical cancer cells demonstrated that TMEM33 silencing inhibits cell proliferation, suggesting a direct role in sustaining cancer cell growth . At the molecular level, TMEM33 expression correlates with several tumorigenesis-related genes including RNF4, OCIAD1, TMED5, DHX15, MED28, and LETM1, with knockdown of TMEM33 resulting in decreased expression of these genes .

Through enrichment analysis, differential expression associated with TMEM33 levels implicates several critical pathways:

  • UPR and ER stress responses: TMEM33 regulates PERK-eIF2α-ATF4 and IRE1-XBP1 signaling axes

  • Immune response regulation: Potentially through assembly with other transmembrane proteins to modulate cGAS-STING pathway

  • Lipid metabolism: As a downstream effector of PKM2 in regulating SREBP activation

  • Calcium homeostasis: In conjunction with PC2, affecting downstream processes including apoptosis sensitivity

Researchers exploring these mechanisms should employ a systems biology approach, combining transcriptomics, proteomics, and functional assays to delineate the specific contributions of each pathway to TMEM33-mediated tumorigenesis.

How can researchers integrate multi-omics approaches to better understand TMEM33 function?

Integrated multi-omics approaches offer powerful strategies for comprehensively characterizing TMEM33 function across biological contexts. An effective integration framework should combine:

  • Transcriptomics: RNA-seq following TMEM33 modulation identifies downstream transcriptional changes, as demonstrated in studies correlating TMEM33 with tumorigenesis-related genes .

  • Proteomics: Proximity-dependent biotin identification (BioID) or APEX2-based proximity labeling can map the TMEM33 interactome within membrane compartments. Quantitative phosphoproteomics can reveal signaling changes downstream of TMEM33, particularly in the UPR pathway where TMEM33 interacts with PERK .

  • Calcium flux analysis: Given TMEM33's role in calcium homeostasis, synchronized calcium imaging with proteomic analysis provides functional correlation data .

  • ChIP-seq or CUT&RUN: These approaches can identify transcription factors activated downstream of TMEM33-mediated UPR signaling, such as ATF4 and XBP1 .

  • Spatial transcriptomics: This emerging technology can reveal localized effects of TMEM33 on gene expression patterns within complex tissues or tumor microenvironments.

Computational integration of these diverse datasets should employ machine learning approaches to identify key regulatory nodes within TMEM33-dependent networks, generating hypotheses for targeted experimental validation.

What are the challenges in developing therapeutic approaches targeting TMEM33?

Developing therapeutic approaches targeting TMEM33 presents several methodological challenges that researchers must address:

  • Targeting specificity: As a transmembrane protein with conserved domains shared with other proteins, achieving selective targeting requires detailed structural information. Current structural data on TMEM33 remains limited, hampering rational drug design approaches.

  • Membrane accessibility: The transmembrane nature of TMEM33 limits accessibility to conventional small molecule approaches. Researchers might need to explore targeted antibodies, peptide mimetics, or lipid-soluble compounds that can access membrane-embedded regions.

  • Context-dependent functions: TMEM33's involvement in fundamental cellular processes including ER stress response and calcium regulation means that targeting must be contextually selective to avoid systemic toxicity . This requires development of cancer-specific delivery systems or exploitation of synthetic lethality approaches.

  • Validation models: Testing TMEM33-targeted therapies requires appropriate model systems that recapitulate its roles in disease. Patient-derived organoids that maintain TMEM33 expression patterns matching the original tumor would provide valuable testing platforms.

  • Biomarker development: For effective therapeutic targeting, reliable biomarkers predicting sensitivity to TMEM33 modulation are essential. The correlation between TMEM33 and immune cell infiltration suggests potential combination with immunotherapy approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.