Recombinant Treponema denticola Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Treponema denticola Flagellar Biosynthetic Protein fliP (fliP)

Recombinant Treponema denticola fliP is a full-length flagellar biosynthetic protein (Q9X5A6) expressed in Escherichia coli and fused with an N-terminal His tag for purification and structural analysis . This protein spans residues 1–271 and is part of the flagellar apparatus critical for motility in oral spirochetes. While specific functional studies on fliP remain limited, its role aligns with conserved flagellar biosynthetic processes in bacteria, including hook assembly, export, and motor regulation .

Molecular Properties

ParameterDetail
Accession NumberQ9X5A6
Length271 amino acids (1–271aa)
Expression SystemE. coli (C-terminal His-tag fusion)
Molecular WeightNot explicitly stated (estimated ~30 kDa based on sequence)
Gene ContextPart of the fla operon, though direct operon membership is unclear

Flagellar Assembly and Motility

Flagellar biosynthesis in T. denticola involves conserved pathways, though structural and regulatory adaptations exist. The fla operon encodes core components like flagellins (FlaA/FlaB), hook proteins (FlgE), and export machinery (FliH/I) . While fliP’s precise function is unexplored, its biosynthetic classification implies roles such as:

  • Export Regulation: Coordination with FliH/FliI for type III secretion system (T3SS) activity.

  • Switch Complex Formation: Interaction with FliG/MotB to control rotational torque .

  • Operon Regulation: Potential involvement in transcriptional cascades, though no sigma factor binding motifs are documented for fliP .

Comparative Insights from Homologs

ProteinFunctionHomologySource
FliP (Salmonella)Export machinery, FliH interactionLimited (no direct BLAST)
Tap1 (T. denticola)Hook-length measurement, essential for motilityDivergent (C-terminal conservation)
FliG (T. denticola)Motor/switch component, chemotaxis55% identity to Bacillus FliG

Experimental Uses

Recombinant fliP is primarily employed in:

  1. Structural Studies: Crystallization for X-ray diffraction or cryo-EM to elucidate flagellar component interactions.

  2. Antigenic Profiling: Serological assays to study immune responses in periodontal disease .

  3. Functional Reconstitution: Co-expression with other flagellar proteins (e.g., FliG, FlgE) to model assembly in vitro .

Production Challenges

ChallengeMitigation Strategies
Low solubility in E. coliFusion partners (e.g., MBP, GST), codon optimization
MisfoldingRefolding protocols, expression at lower temperatures
Limited yieldHigh-copy plasmids, induction optimization (e.g., IPTG)

Data from related flagellar proteins indicate that T. denticola genes often require specialized expression systems due to differences in codon usage and chaperone requirements .

Gaps in Current Knowledge

Key unresolved questions include:

  1. Operon Position: Whether fliP is transcribed as part of the fla operon or as a standalone gene.

  2. Functional Interactions: Partners in the basal body or export apparatus.

  3. Pathogenic Role: Contribution to biofilm formation or host immune evasion, as seen with other flagellar proteins .

Future studies should prioritize genetic knockouts and interactome mapping to define fliP’s mechanistic role in T. denticola motility and pathogenesis.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specification.
Synonyms
fliP; TDE_2760; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222)
Target Names
fliP
Target Protein Sequence
MKKNLLILVFFGMILFIPVQVFSQSRFPEGTTAGRTDADPNRQAGRIPFIDFSIREPSTN KDVAFSVQLLIFITLISIAPSLLLLMTSFLRLSIVLDFVKRALSLQQVPPTQVLNGIAFF LTLFIMWPTFTQIYNNAYKPMSEGQIGIEEAYREAEKPMRYFMYKQMQKNPTHIRTFMAM SKLPKPDTLADVPTHILIAAFILHELTIAFQIGIFLYLPFIIIDMIVASILMSMGMIMLP PVQISMPFKLILFVMVDGWGLLFGKLFESFL
Uniprot No.

Target Background

Function
Plays a role in the flagellum-specific transport system.
Database Links

KEGG: tde:TDE2760

STRING: 243275.TDE2760

Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What are the optimal systems for recombinant expression of T. denticola FliP?

For recombinant expression of T. denticola FliP, E. coli-based expression systems have proven most effective. The following methodological approaches are recommended:

  • Expression Vector Selection: Vectors containing the T7 promoter system have shown high efficiency for FliP expression. Plasmids that include an N-terminal His-tag facilitate subsequent purification steps .

  • Host Strain Optimization: E. coli strains such as BL21(DE3) are preferred due to their reduced protease activity and optimization for T7 promoter-based expression .

  • Temperature Modulation: Lowering the expression temperature to 33°C has been demonstrated to significantly enhance the yield of properly folded recombinant proteins in HEK-293 cells, and similar principles apply to bacterial expression systems. This mild hypothermia reduces growth rate while increasing cellular productivity of recombinant proteins .

  • Induction Parameters: For IPTG-inducible systems, an IPTG concentration of 0.5-1.0 mM with induction at mid-log phase (OD600 of 0.6-0.8) yields optimal expression levels for membrane proteins like FliP .

  • Chromosomal Integration Approach: For long-term stable expression without antibiotic selection pressure, the Chromosomal Vector (ChroV) system can be employed. This involves inserting the FliP gene with an RMT cassette into the F′ plasmid of E. coli JM109(DE3), allowing for stable, inducible expression .

How can researchers optimize the purification of recombinant FliP protein?

Purification of recombinant FliP requires specialized approaches due to its membrane-associated properties:

  • Cell Lysis Optimization: For membrane proteins like FliP, gentle lysis methods using specialized detergents are recommended. A combination of lysozyme (100 μg/ml) with mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration effectively solubilizes membrane proteins while preserving structure .

  • Affinity Chromatography Protocol: For His-tagged FliP:

    • Equilibrate Ni-NTA resin with buffer containing 20 mM Tris-HCl pH 8.0, 500 mM NaCl, 20 mM imidazole, and 0.1% DDM

    • Apply clarified lysate and wash extensively

    • Elute with an imidazole gradient (50-300 mM)

    • Monitor purification using SDS-PAGE with Western blot confirmation

  • Buffer Optimization: Stabilization of purified FliP is achieved using Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, addition of 50% glycerol and storage at -20°C/-80°C is recommended .

  • Reconstitution Methodology: Lyophilized FliP protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol is recommended for long-term storage, with 50% being optimal .

What methodologies are available for creating FliP mutants in T. denticola?

Construction of FliP mutants in T. denticola requires specialized genetic approaches due to the challenging nature of spirochete genetic manipulation:

How should researchers design experiments to analyze FliP mutant phenotypes?

When analyzing FliP mutant phenotypes, a multi-faceted approach is recommended:

  • Motility Assays:

    • Liquid culture observation using dark-field microscopy

    • Swarming assays on semi-solid agar to quantify spreading ability

    • Track cells using video microscopy with specialized software for quantitative analysis

  • Ultrastructural Analysis:

    • Electron microscopy to visualize flagellar structures

    • High-voltage electron microscopy for detailed examination of periplasmic flagella arrangement

    • Negative staining to examine flagellar filaments and hook structures

  • Protein Expression Analysis:

    • Immunoblotting to assess flagellar protein levels (FlaA, FlaB, FlgE)

    • RNA extraction and RT-PCR to evaluate transcriptional effects

    • Quantitative proteomics to identify changes in protein abundance profiles

  • Functional Assays:

    • Biofilm formation assays, particularly in co-culture with other periodontal pathogens like P. gingivalis

    • Coaggregation assays to assess interaction with other oral bacteria

    • Assessment of spirochete morphology using dark-field microscopy

How does FliP contribute to T. denticola virulence and biofilm formation?

FliP's role in T. denticola virulence extends beyond simple motility functions:

  • Biofilm Formation: Flagellar proteins, including FliP, are critical for the synergistic biofilm formation between T. denticola and other periodontal pathogens, particularly P. gingivalis. Studies with flagellar mutants have shown that:

    • Wild-type T. denticola and P. gingivalis form dual-species biofilms with a 2-fold higher biomass than the sum of their monospecies biofilms

    • Deletion of flagellar genes reduces this synergy, with a 5-fold reduction in dual-species biofilm biomass observed with motility-specific mutants

  • Cell Morphology Regulation: FliP, as part of the flagellar export apparatus, influences the distinctive morphology of T. denticola:

    • Wild-type cells typically display an irregular twisted morphology with both planar and helical regions

    • Flagellar-deficient mutants show altered morphology, typically becoming regular right-handed helices

    • These morphological differences may affect tissue penetration capabilities

  • Immune Evasion: The motility provided by properly assembled flagella, dependent on FliP function, allows T. denticola to evade host immune responses and penetrate tissues, contributing to periodontal disease progression .

What is known about the regulatory network controlling FliP expression?

The expression of FliP in T. denticola is regulated through a complex network:

  • Operon Organization: FliP is part of the fla operon, which contains numerous motility-related genes. The organization of this operon has been characterized:

    • The tap1 gene is the initial gene of this operon

    • The operon includes genes for flagellar components arranged in a hierarchical structure

    • Transcription studies using reverse transcriptase PCR have confirmed co-transcription of these genes

  • Regulatory Elements: Several regulatory factors influence FliP expression:

    • Sigma factors, particularly sigma28-like elements, have been identified as important for flagellar gene expression

    • A transcriptional start site 5' to the flgB gene with an appropriately spaced sigma28 binding motif has been identified

    • The AtcR LytTR domain-containing response regulator has been shown to interact with LytTR recognition sequences found upstream of 26 T. denticola genes, potentially including flagellar genes

  • Hierarchical Regulation: Expression follows a hierarchical pattern:

    • Completion of hook-basal body structure serves as a checkpoint for transcriptional regulation

    • Post-transcriptional controls also influence protein abundance

    • Mutations in one flagellar gene often affect the expression of other flagellar components

How can researchers analyze interactions between FliP and other flagellar proteins?

Several methodological approaches are recommended for studying FliP interactions:

  • Co-Immunoprecipitation Techniques:

    • Use anti-FliP antibodies to pull down protein complexes

    • Identify interacting partners through mass spectrometry

    • Confirm interactions using reverse co-IP with antibodies against putative partners

  • Bacterial Two-Hybrid System:

    • Adapt bacterial two-hybrid systems for membrane proteins

    • Create fusion constructs of FliP and potential interacting partners

    • Screen for protein-protein interactions based on reporter gene activation

  • Crosslinking Studies:

    • Use membrane-permeable crosslinkers to stabilize transient interactions

    • Analyze crosslinked complexes by mass spectrometry

    • The unique structure of spirochete FlgE proteins, which form covalent cross-links unlike in other bacteria, provides a model for studying such interactions

  • Heterologous Expression Studies:

    • Express treponemal flagellar genes in enteric bacteria

    • Analyze effects on motility and flagellar assembly

    • Studies have shown that expression of T. denticola fliG in enteric bacteria interferes with motility, demonstrating functional conservation and interaction potential

How should researchers address common challenges in FliP expression and purification?

ChallengePossible CausesRecommended Solution
Low expression yieldToxicity to host cells, protein instabilityLower induction temperature to 33°C, reduce IPTG concentration, use tightly regulated expression systems
Inclusion body formationRapid overexpression, improper foldingExpress at lower temperatures, use solubility-enhancing fusion tags, optimize induction conditions
Poor solubilityMembrane protein characteristicsUse appropriate detergents (DDM, CHAPS), optimize buffer conditions, consider fusion partners
Protein degradationProtease activityInclude protease inhibitors, use protease-deficient strains, optimize purification speed
Low purityNon-specific binding to resinIncrease imidazole in wash buffers, consider tandem purification approaches, optimize salt concentration

When troubleshooting FliP expression issues, a systematic approach is recommended:

  • First, optimize expression conditions by modulating temperature, with mild hypothermia (33°C) often improving yield and proper folding .

  • If protein remains insoluble, explore detergent screening with a focus on mild detergents compatible with membrane proteins.

  • For degradation issues, incorporate protease inhibitor cocktails and minimize exposure time during purification steps.

  • Consider chromosomal integration approaches like the ChroV system for stable, long-term expression without antibiotic selection pressure .

How should contradictory data on FliP function be interpreted?

When faced with contradictory results regarding FliP function:

  • Consider Strain Variations: Different T. denticola strains (e.g., ATCC 35405 vs. ATCC 33520) may show variations in flagellar gene function and regulation. Compare experimental conditions and strain backgrounds when interpreting conflicting data .

  • Assess Polar Effects: In flagellar gene mutants, polar effects on downstream genes may occur. For example, in tap1 inactivation studies, potential polar effects from the erythromycin resistance cassette were addressed by using a modified cassette lacking the putative ermF transcription terminator .

  • Evaluate Pleiotropy: The inactivation of motility-associated genes may have effects beyond motility. For example, motB inactivation affected 326 proteins beyond those directly involved in motility, upregulating cellular stress responses .

  • Examine Methodology Differences: Conflicting data may result from differences in:

    • Mutant construction methodologies

    • Protein expression systems

    • Assay conditions for motility and biofilm formation

    • Analytical techniques used for protein quantification

  • Consider Multi-Protein Interactions: FliP functions as part of a complex system. The effect of its mutation may depend on the status of other flagellar components and their interactions within the specific experimental context .

What are promising approaches for studying FliP's role in periodontal disease progression?

Future research on FliP should consider these promising directions:

  • In vivo Models: Develop improved animal models that better recapitulate human periodontal disease to study the contribution of FliP-dependent motility to disease progression.

  • Human Oral Microbiome Studies: Investigate the expression patterns of FliP in clinical samples from periodontal disease patients compared to healthy controls using metaproteomic approaches.

  • Targeted Anti-Motility Therapeutics: Develop specific inhibitors of FliP function as potential therapeutic agents for periodontal disease, focusing on disrupting the flagellar export apparatus without general antibacterial effects.

  • Cross-Species Synergy Mechanisms: Further explore the molecular basis for the synergistic biofilm formation between T. denticola and other periodontal pathogens, with a focus on the role of FliP and other flagellar proteins .

  • Structural Biology Approaches: Apply advanced structural biology techniques such as cryo-electron microscopy to elucidate the three-dimensional structure of the flagellar export apparatus including FliP, which could facilitate structure-based drug design.

How can researchers leverage advanced technologies to better understand FliP function?

Several cutting-edge approaches should be considered:

  • CRISPR-Cas Adaptation: Adapt CRISPR-Cas genome editing technologies for precision engineering of T. denticola flagellar genes, allowing for more subtle mutations than traditional knockout approaches.

  • Single-Cell Analysis: Apply single-cell tracking and analysis methods to study heterogeneity in motility phenotypes within T. denticola populations following FliP manipulation.

  • Advanced Imaging Techniques: Utilize super-resolution microscopy and correlative light-electron microscopy to visualize flagellar assembly processes with unprecedented detail.

  • Systems Biology Integration: Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models of flagellar gene regulation networks, including FliP's position within these networks .

  • Microfluidic Approaches: Develop specialized microfluidic devices to study T. denticola motility and chemotaxis under controlled gradient conditions, allowing for quantitative assessment of FliP's contribution to these behaviors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.