Recombinant Treponema denticola Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence Overview

The T. denticola YidC sequence (582 residues) includes motifs critical for membrane integration:

SegmentSequence (Partial)Functional Role
N-TerminusMKKNTVLAVVLSM LVFGGWLYIQQKYFPTEYNVPQKPVAQAQGQNPTSSEIAVQTSSNQI SNSMIEAVADSDYPSREQTYVIETDIIRAVFTNKGGDIISYKLKEHASAGSDERVEMIEN VTERNRALSLALGGHDAQAVDLLFNVKEESLSDGRKQIGFYRDIKLKNTDGSETVFTLAK RYTFIPGDYMFTLEVTIDGKEGMRGLSFGDSAYTLRSAPQIGPEWDKVNDKYEYRALSYF ANEKKKEDRSITDGKTKAVNDLASWVSVSGKYFSFIIIPKDPIQKMFFSGIKEEGAKLHN SQFFISRQPIVGNAAYDQYRVYIGPSSEKILNSYNSAAANNYGYENLRIDSLAASSGFLA PLERVLKFVMEIFYKIIPNWGVALLLLTLLMRIIFFPLTKKSSEATKRMQELQPQINELQ QKYKNNPQKLNAEMVKFYKEAGYNPASGCLPLLIQLPFLFAMFGLFNNYFEFRGASFIPG WIPDLSVGDSILKFGFTIPFLNWTDLRLLPIIYTASQLLHGKLTQTPGQSQQNPSMKIMI YFMPLFFFFLFYNAPSGLLLFWTFSNILmLLQQLIINKSMKKMembrane insertion, protein folding

Functional Role in Membrane Protein Biogenesis

YidC operates via two primary pathways:

  1. Sec-Independent Insertion: Directly integrates small membrane proteins (e.g., Pf3 coat protein) into lipid bilayers .

  2. Sec-Dependent Assistance: Collaborates with SecYEG to facilitate the lateral movement of transmembrane (TM) segments during co-translational insertion .

Key Functional Domains

DomainRoleEvidence
TM1–TM5 BundleForms hydrophilic groove for substrate passageMD simulations show bilayer thinning near TM3/TM5
C1 LoopRibosome interaction siteCrosslinking studies identify ribosome-YidC contact
C-Terminal TailSubstrate docking platformMutagenesis disrupts membrane insertion efficiency

Recombinant YidC in Research Applications

Recombinant T. denticola YidC is employed in studies probing membrane biogenesis and protein folding:

  • In Vitro Insertion Assays: Purified YidC reconstituted in proteoliposomes catalyzes Pf3 coat protein insertion, achieving 150 substrates per YidC molecule .

  • Structural Studies: Cryo-EM reconstructions reveal ribosome-YidC complexes, highlighting insertion sites at the YidC-lipid interface .

  • Diagnostic Tools: ELISA kits utilize recombinant YidC for detecting T. denticola antigens .

Research Challenges and Future Directions

  1. Mechanistic Gaps: Exact substrate translocation pathway through YidC’s hydrophilic groove remains unclear .

  2. Species-Specific Adaptations: T. denticola YidC may exhibit unique lipid interactions or substrate specificity compared to E. coli .

  3. Therapeutic Targets: Inhibiting YidC could disrupt T. denticola membrane protein biogenesis, offering novel antibacterial strategies.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you have a specific format requirement, please include it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery time information, please consult your local distributor.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yidC; TDE_2396; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222)
Target Names
yidC
Target Protein Sequence
MKKNTVLAVVLSMLVFGGWLYIQQKYFPTEYNVPQKPVAQAQGQNPTSSEIAVQTSSNQI SNSMIEAVADSDYPSREQTYVIETDIIRAVFTNKGGDIISYKLKEHASAGSDERVEMIEN VTERNRALSLALGGHDAQAVDLLFNVKEESLSDGRKQIGFYRDIKLKNTDGSETVFTLAK RYTFIPGDYMFTLEVTIDGKEGMRGLSFGDSAYTLRSAPQIGPEWDKVNDKYEYRALSYF ANEKKKEDRSITDGKTKAVNDLASWVSVSGKYFSFIIIPKDPIQKMFFSGIKEEGAKLHN SQFFISRQPIVGNAAYDQYRVYIGPSSEKILNSYNSAAANNYGYENLRIDSLAASSGFLA PLERVLKFVMEIFYKIIPNWGVALLLLTLLMRIIFFPLTKKSSEATKRMQELQPQINELQ QKYKNNPQKLNAEMVKFYKEAGYNPASGCLPLLIQLPFLFAMFGLFNNYFEFRGASFIPG WIPDLSVGDSILKFGFTIPFLNWTDLRLLPIIYTASQLLHGKLTQTPGQSQQNPSMKIMI YFMPLFFFFLFYNAPSGLLLFWTFSNILMLLQQLIINKSMKK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as in the incorporation of some lipoproteins. It assists in the folding of multispanning membrane proteins.
Database Links

KEGG: tde:TDE2396

STRING: 243275.TDE2396

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of YidC in Treponema denticola?

YidC in T. denticola, similar to its homologs in other bacteria, functions as a membrane protein insertase that facilitates the integration of newly synthesized proteins into the bacterial membrane. Based on structural and functional studies of bacterial YidC proteins, T. denticola YidC likely plays a critical role in the biogenesis of membrane proteins by interacting with ribosomes to co-translationally insert nascent polypeptide chains into the bacterial membrane .

The protein is expected to thread back and forth through the membrane multiple times, with portions extending into the cytoplasm where it can interact with the ribosome at the site where newly formed protein chains exit . This interaction creates a protected environment that allows hydrophobic segments of nascent membrane proteins to partition into the lipid bilayer.

How does the structure of T. denticola YidC compare to E. coli YidC?

While specific structural data for T. denticola YidC is not abundantly available in the literature, inferences can be made based on known YidC structures. E. coli YidC has been characterized using evolutionary co-variation analysis, lipid-versus-protein-exposure experiments, and molecular dynamics simulations . The structure reveals a protein that threads through the membrane five times with portions extending into the bacterial cytoplasm.

For T. denticola YidC, researchers would need to:

  • Perform sequence alignment with E. coli YidC to identify conserved domains

  • Apply similar evolutionary co-variation analysis to predict contact points between residues

  • Construct a multiple sequence alignment excluding non-conserved regions

  • Compute direct evolutionary couplings between pairs of YidC residues

  • Use this data to predict transmembrane regions and structural features

This comparative approach would help identify unique structural features of T. denticola YidC that might relate to its specific functions in this oral pathogen.

What experimental approaches should be used to study the association of YidC with other T. denticola membrane proteins?

To study the association of YidC with other T. denticola membrane proteins, researchers should consider multiple complementary approaches:

  • Co-immunoprecipitation studies: Using antibodies against YidC to pull down protein complexes, followed by mass spectrometry analysis to identify interacting partners. This approach has been successful in identifying protein associations in T. denticola, as demonstrated with MOSP studies .

  • Crosslinking experiments: Chemical crosslinking of proteins in intact cells followed by identification of crosslinked products can reveal transient or weak interactions.

  • Indirect immunofluorescence analysis (IFA): Similar to methods used to localize MOSP domains, researchers can use IFA with intact and detergent-treated organisms to identify surface-exposed versus periplasmic domains of YidC and its interacting partners .

  • Surface proteolysis: Proteinase K treatment of intact bacteria can help determine which portions of YidC are surface-exposed versus periplasmic, as demonstrated with MOSP protein .

  • Novel cell fractionation schemes: These can separate outer membrane and periplasmic protein conformers to study their distinct interaction networks .

How might YidC contribute to the assembly of virulence factors in T. denticola?

YidC likely plays a crucial role in the assembly of T. denticola virulence factors by facilitating the insertion of key membrane proteins. T. denticola's pathogenicity is largely mediated by membrane proteins such as the major outer sheath protein (MOSP) and components of the dentilisin protease complex .

The dentilisin complex, formed by proteins PrtP, PrcA1, PrcA2, and PrcB, is particularly important for T. denticola virulence as it promotes bacterial penetration of epithelial cells by digesting tight junctional and extracellular matrix proteins . YidC may facilitate the proper insertion of these components into the membrane, which is crucial for the assembly of functional protease complexes.

Research approaches to investigate this connection include:

  • Creating conditional YidC knockdown mutants to observe effects on virulence factor assembly

  • Studying the co-localization of YidC with virulence factor precursors during assembly

  • Analyzing membrane protein composition in YidC-depleted cells to identify dependent substrates

  • Using in vitro reconstitution assays with purified components to directly test YidC's role in inserting specific virulence factors

What methodologies can be applied to study the structure-function relationship of T. denticola YidC?

To elucidate the structure-function relationship of T. denticola YidC, researchers should employ a multi-faceted approach:

  • Cryo-electron microscopy (cryo-EM):

    • Capture the structure of YidC bound to ribosomes during active protein synthesis

    • Visualize YidC-substrate complexes at various stages of membrane insertion

    • This technique has successfully revealed how YidC interacts with ribosomes at the exit site for nascent chains

  • Site-directed mutagenesis:

    • Target conserved residues predicted to be important for ribosome binding or substrate interaction

    • Assess the effect of mutations on YidC function using in vivo complementation assays

    • Test mutant proteins for altered binding to ribosomes or substrate proteins

  • Evolutionary covariation analysis:

    • Construct multiple sequence alignments of YidC homologs

    • Compute direct evolutionary couplings between pairs of residues

    • Use this data to predict structurally and functionally important residue pairs

  • Molecular dynamics simulations:

    • Model the interaction between YidC, membranes, and substrate proteins

    • Simulate conformational changes during the insertion process

    • Predict energetic barriers and facilitating interactions

  • Cross-linking and mass spectrometry:

    • Identify residues that interact with substrate proteins during insertion

    • Map the pathway taken by substrates through the YidC protein

How do environmental factors affect the expression and function of T. denticola YidC?

Understanding how environmental factors influence YidC expression and function is crucial given T. denticola's habitat in the subgingival plaque, where conditions can fluctuate dramatically. Research approaches should include:

  • Gene expression analysis under varying conditions:

    • pH changes (reflective of periodontal pocket acidification during disease)

    • Oxygen tension (T. denticola is an anaerobe, but may experience microaerobic conditions)

    • Nutrient availability (particularly amino acids and peptides)

    • Presence of host factors (inflammatory mediators, antimicrobial peptides)

  • Stress response studies:

    • Heat shock (to mimic inflammation-induced temperature increases)

    • Osmotic stress (due to gingival crevicular fluid flow changes)

    • Oxidative stress (from host immune response)

  • Co-culture experiments:

    • With other members of the "Red Complex" (P. gingivalis, T. forsythia)

    • With host cells to determine if host interaction alters YidC expression

  • In vivo expression studies:

    • Analysis of YidC expression in samples from different stages of periodontal disease

    • Comparison between active sites of disease and healthy control sites

These approaches would help determine if YidC expression is constitutive or regulated in response to environmental conditions, providing insights into T. denticola's adaptation to the periodontium.

What role might YidC play in the biogenesis of MOSP in T. denticola?

The major outer sheath protein (MOSP) is a prominent virulence determinant of T. denticola with a complex bipartite structure . YidC could be instrumental in the proper assembly and localization of this protein.

Research indicates that MOSP consists of N-terminal (MOSP N) and C-terminal (MOSP C) domains, with MOSP C forming amphiphilic trimers embedded in the outer membrane, while MOSP N forms extended hydrophilic monomers residing in the periplasm . This complex topology suggests a sophisticated membrane insertion process that might involve YidC.

Evidence from studies on MOSP shows that:

  • MOSP exists as distinct conformers in the outer membrane and periplasm

  • Only the OM-MOSP conformer associates with the dentilisin complex

  • MOSP C is OM-embedded and surface-exposed, while MOSP N resides in the periplasm

To investigate YidC's role in MOSP biogenesis, researchers should:

  • Create conditional YidC mutants and observe effects on MOSP assembly

  • Perform in vitro reconstitution assays with purified YidC and MOSP precursors

  • Use fluorescence resonance energy transfer (FRET) to detect direct interactions between YidC and MOSP during membrane insertion

  • Compare the assembly pathway of MOSP in T. denticola with that of heterologously expressed MOSP in E. coli, where differences might highlight T. denticola-specific factors

What expression systems are optimal for producing functional recombinant T. denticola YidC?

Choosing the appropriate expression system for recombinant T. denticola YidC is critical for obtaining functional protein for structural and biochemical studies. Several systems should be considered:

  • E. coli-based expression systems:

    • Advantages: Well-established protocols, high yield, easy genetic manipulation

    • Considerations: May require fusion with a periplasmic targeting sequence (like PelB) to ensure proper membrane insertion, as was effective for MOSP expression

    • Recommended strains: C41(DE3) or C43(DE3), which are designed for membrane protein expression

    • Expression vectors: pET series with regulatable T7 promoter or pBAD vectors with arabinose-inducible promoters

  • Cell-free expression systems:

    • Advantages: Avoids toxicity issues, allows direct incorporation into artificial liposomes

    • Considerations: Requires supplementation with lipids and chaperones

    • Protocol modifications: Include E. coli total membrane extracts to provide a native-like environment

  • Homologous expression in T. denticola:

    • Advantages: Native processing and folding environment

    • Considerations: More technically challenging, lower yields

    • Genetic tools: Use of shuttle vectors and inducible promoters specific for T. denticola

Expression optimization parameters:

  • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

  • Induction: Gentle induction with low inducer concentrations

  • Media: Supplementation with specific lipids may improve proper folding

  • Detergents: Careful selection for extraction is critical (LDAO, DDM, or FC-12 are commonly used)

What purification strategies maintain the stability and function of recombinant T. denticola YidC?

Purifying membrane proteins while maintaining their native conformation is challenging. For T. denticola YidC, researchers should consider:

  • Affinity tags selection:

    • His6 or His10 tags at either N- or C-terminus, with TEV protease cleavage sites

    • Test multiple tag positions to identify constructs with minimal functional interference

    • Consider Strep-tag II as an alternative if metal affinity purification proves problematic

  • Membrane extraction:

    • Begin with gentle detergents like DDM, LMNG, or GDN

    • Screen detergent concentrations to minimize protein aggregation

    • Consider detergent mixtures or lipid-detergent mixed micelles to better mimic native environment

  • Purification protocol:

    • First step: Metal affinity chromatography (IMAC) for His-tagged constructs

    • Second step: Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Optional intermediate step: Ion exchange chromatography for higher purity

  • Stability enhancement:

    • Add lipids during purification (E. coli polar lipids or defined mixtures)

    • Include glycerol (10-15%) to prevent aggregation

    • Consider purification in nanodiscs or amphipols for enhanced stability

  • Quality control:

    • Analytical size exclusion chromatography to assess oligomeric state

    • Circular dichroism to confirm secondary structure

    • Thermal stability assays to optimize buffer conditions

    • Functional assays to confirm activity post-purification

What experimental approaches can be used to study the membrane protein insertase activity of recombinant T. denticola YidC?

To study the insertase activity of recombinant T. denticola YidC, researchers should employ multiple complementary approaches:

  • In vitro translation-insertion assays:

    • Reconstitute YidC into liposomes or nanodiscs

    • Use cell-free translation systems to synthesize labeled substrate proteins

    • Measure insertion by protease protection assays or fluorescence quenching

    • Compare activity with and without ribosomes to distinguish co-translational and post-translational insertion

  • Site-specific crosslinking:

    • Incorporate photo-activatable amino acids at specific positions in YidC

    • Identify interaction sites with substrate proteins during the insertion process

    • Map the pathway taken by substrates through the YidC protein

  • Fluorescence-based assays:

    • Label YidC and substrate proteins with fluorescent probes

    • Monitor insertion kinetics in real-time using FRET or fluorescence quenching

    • Determine the effects of mutations on insertion efficiency

  • Electrophysiological measurements:

    • Reconstitute YidC into planar lipid bilayers or giant unilamellar vesicles

    • Measure conductance changes during substrate insertion

    • This approach has been successful for studying MOSP's porin activity

  • In vivo complementation assays:

    • Express T. denticola YidC in YidC-depleted E. coli strains

    • Assess complementation by measuring growth and membrane protein levels

    • Use reporter substrate proteins to quantify insertion efficiency

How can researchers study the interaction between T. denticola YidC and the ribosome?

Understanding the YidC-ribosome interaction is crucial for elucidating co-translational protein insertion mechanisms. Researchers should consider these approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Visualize YidC-ribosome nascent chain complexes at near-atomic resolution

    • Identify binding interfaces and conformational changes during insertion

    • Compare with known structures of E. coli YidC-ribosome complexes

  • Ribosome binding assays:

    • Purify ribosomes or ribosomal large subunits

    • Use surface plasmon resonance or microscale thermophoresis to measure binding affinities

    • Compare wild-type YidC with mutants to identify key interaction residues

  • Co-sedimentation assays:

    • Mix purified YidC (in detergent, nanodiscs, or proteoliposomes) with ribosomes

    • Sediment complexes by ultracentrifugation

    • Analyze bound components by SDS-PAGE and western blotting

  • Cross-linking coupled with mass spectrometry:

    • Use bifunctional crosslinkers to capture YidC-ribosome interactions

    • Identify crosslinked residues by mass spectrometry

    • Create detailed interaction maps at the amino acid level

  • Fluorescence-based approaches:

    • Label YidC and ribosomes with fluorescent probes

    • Use fluorescence correlation spectroscopy to measure binding kinetics

    • Apply single-molecule FRET to observe dynamic interactions during translation

How should researchers interpret evolutionary conservation patterns in T. denticola YidC?

Analyzing evolutionary conservation patterns in T. denticola YidC provides insights into functionally important regions. Researchers should:

  • Perform multiple sequence alignment:

    • Include YidC sequences from diverse bacterial species

    • Pay special attention to other oral spirochetes and pathogenic treponemes

    • Consider separate alignments for different bacterial phyla to identify spirochete-specific features

  • Calculate conservation scores:

    • Use algorithms like ConSurf or Rate4Site to quantify conservation

    • Map conservation scores onto structural models

    • Identify highly conserved patches that may represent functional sites

  • Apply coevolutionary analysis:

    • Calculate direct evolutionary couplings between residue pairs

    • Use methods similar to those applied for E. coli YidC

    • Identify co-evolving networks that may represent functional units

  • Interpret conservation in context:

    • Highly conserved residues across all bacteria likely represent core insertase function

    • Residues conserved only in spirochetes may relate to spirochete-specific substrates

    • Variable regions might interact with species-specific partners

  • Validate computational predictions:

    • Target conserved residues for mutagenesis

    • Test effects on protein stability, ribosome binding, and insertase activity

    • Correlate functional defects with conservation patterns

What approaches should be used to compare the substrate specificity of T. denticola YidC with homologs from other bacteria?

Understanding substrate specificity differences between T. denticola YidC and homologs from other bacteria requires systematic comparative analysis:

  • Bioinformatic prediction of substrates:

    • Analyze membrane proteomes of T. denticola and model organisms like E. coli

    • Look for T. denticola-specific membrane proteins that might be YidC substrates

    • Focus particularly on virulence factors like components of the dentilisin complex

  • Heterologous complementation assays:

    • Express T. denticola YidC in YidC-depleted E. coli

    • Assess insertion of known E. coli YidC substrates

    • Identify substrates that are efficiently versus poorly inserted

  • Reciprocal expression experiments:

    • Express other bacterial YidC proteins in T. denticola (if genetic tools permit)

    • Test complementation of T. denticola YidC depletion phenotypes

    • Assess insertion of T. denticola-specific membrane proteins

  • In vitro insertion assays with diverse substrates:

    • Reconstitute purified YidC proteins from different species into liposomes

    • Test insertion efficiency with a panel of substrate proteins

    • Compare kinetic parameters to identify specificity determinants

  • Chimeric protein analysis:

    • Create chimeric YidC proteins with domains from T. denticola and E. coli

    • Test which domains confer substrate specificity

    • Map specificity determinants to specific regions or residues

How might targeting T. denticola YidC inform development of novel periodontal disease interventions?

YidC is essential for membrane protein biogenesis, making it a potential target for antimicrobial development. Research in this direction should:

  • Identify unique features of T. denticola YidC:

    • Structural differences from human membrane protein insertion machinery

    • T. denticola-specific substrate binding sites or regulatory mechanisms

    • Interaction interfaces with T. denticola-specific virulence factors

  • Develop high-throughput screening assays:

    • In vitro assays measuring insertion of fluorescently labeled substrates

    • Cell-based assays using reporter substrates in T. denticola or surrogate hosts

    • Fragment-based screening against purified T. denticola YidC

  • Explore peptide inhibitors:

    • Design peptides mimicking YidC-binding regions of substrate proteins

    • Test competitive inhibition of natural substrate insertion

    • Optimize for stability and membrane permeability

  • Consider combination approaches:

    • Target YidC in combination with inhibitors of other virulence pathways

    • Explore synergy with traditional periodontal treatments

    • Develop targeted delivery systems for the subgingival environment

  • Address potential challenges:

    • Selectivity for bacterial versus human membrane protein biogenesis

    • Delivery to the subgingival pocket environment

    • Resistance development potential

What techniques should be used to investigate potential post-translational modifications of T. denticola YidC?

Post-translational modifications (PTMs) can significantly impact protein function. To investigate PTMs in T. denticola YidC:

  • Mass spectrometry-based approaches:

    • Immunoprecipitate native YidC from T. denticola cells

    • Perform LC-MS/MS analysis with multiple proteases to achieve high sequence coverage

    • Use neutral loss scanning to detect phosphorylation, glycosylation, and other modifications

  • Site-specific modification detection:

    • Use phospho-specific antibodies to detect phosphorylation

    • Apply glycan-specific staining methods to detect glycosylation

    • Employ chemical labeling strategies for cysteine modifications

  • Temporal analysis:

    • Compare PTM profiles under different growth conditions

    • Examine changes during different growth phases

    • Assess modifications in response to stress conditions

  • Functional impact assessment:

    • Create site-directed mutants at identified modification sites

    • Test effects on YidC stability, localization, and insertase activity

    • Identify the enzymes responsible for specific modifications

  • Comparative analysis with other species:

    • Compare PTM patterns with YidC from model organisms

    • Identify T. denticola-specific modifications

    • Correlate unique modifications with functional differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.