Recombinant Treponema denticola Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Treponema denticola Prolipoprotein Diacylglyceryl Transferase (lgt)

Recombinant Treponema denticola Prolipoprotein Diacylglyceryl Transferase (lgt) is a recombinant protein derived from the bacterium Treponema denticola, a periodontal pathogen known for its role in periodontal diseases. This enzyme plays a crucial role in the modification of prolipoproteins by transferring a diacylglyceryl group from phosphatidylglycerol to the cysteine residue of prolipoproteins, facilitating their maturation and integration into bacterial membranes.

Function and Importance of lgt

The lgt enzyme is essential for bacterial growth and survival, as it enables the proper modification and anchoring of lipoproteins in the bacterial membrane. Lipoproteins are vital for various cellular processes, including nutrient uptake, cell signaling, and virulence factor expression. In Treponema denticola, the lgt enzyme is crucial for maintaining the structural integrity of the cell membrane and ensuring the proper functioning of lipoproteins involved in pathogenicity.

Characteristics of Recombinant Treponema denticola Prolipoprotein Diacylglyceryl Transferase (lgt)

  • Species Origin: The recombinant protein is derived from Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222).

  • Uniprot Number: P60974.

  • Tag Information: The tag type is determined during the production process.

  • Storage Buffer: Tris-based buffer with 50% glycerol.

  • Storage Conditions: Store at -20°C for short-term storage or -80°C for extended storage. Repeated freezing and thawing is not recommended.

  • Amino Acid Sequence: The sequence includes several hydrophobic regions typical of membrane-associated proteins.

Data Table: Characteristics of Recombinant Treponema denticola Prolipoprotein Diacylglyceryl Transferase (lgt)

CharacteristicDescription
Species OriginTreponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222)
Uniprot NumberP60974
Tag InformationDetermined during production
Storage BufferTris-based buffer with 50% glycerol
Storage ConditionsStore at -20°C or -80°C; avoid repeated freezing/thawing
Amino Acid SequenceIncludes hydrophobic regions typical of membrane proteins

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing that tag.
Synonyms
lgt; TDE_1399; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222)
Target Names
lgt
Target Protein Sequence
MLLAIQYPSWLHPEIIPGLPFLRWYGLMYLVAFGIAYFLFSYQVKHGEFERYSGCQKAMT QDDISDLFIWGILGLILGARIFGTLVYNPETYLKAPWLIFWPFARDGAGNLTFTGFQGMS YHGGFIGGFLGVILWTKKSKFKFAAVADLMAVSIPLGYTFGRLGNFANGELYGRITTSKI GMIFPQTPISDRFYLAESWVRDFAEQAGLLVQDGASMINLPRHPSQLYEAFFEGIILWLI LWLLRKKKPFDGFLVCVYTLGYGFFRFFIEYFRQPDANKGYPISFGTGAANIYVYESWKN ISTGQILCSLMILASLAAMLILYLQEKKLKEKKGNIDG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: tde:TDE1399

STRING: 243275.TDE1399

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Treponema denticola prolipoprotein diacylglyceryl transferase and what is its function?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first step in bacterial lipoprotein biogenesis. In Treponema denticola, as in other bacteria, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox sequence of prolipoprotein substrates, forming a thioether bond . This post-translational modification is essential for proper lipoprotein trafficking and anchoring to the bacterial membrane. The lipid modification process is critical for T. denticola survival and virulence in periodontal disease progression .

T. denticola belongs to oral treponemes, with more than 75 species/species-level phylotypes inhabiting the human oral cavity. These organisms are commonly associated with periodontal disease, with T. denticola being particularly prevalent in subjects with both gingivitis and periodontitis .

Why is studying recombinant T. denticola Lgt valuable for periodontal disease research?

Studying recombinant T. denticola Lgt provides several research advantages:

  • Mechanistic insights: Understanding the molecular mechanisms of T. denticola lipoprotein biogenesis helps elucidate how this periodontal pathogen maintains cell envelope architecture and virulence functions.

  • Microbial ecology: T. denticola is part of complex polymicrobial communities in periodontal disease. Characterizing its Lgt helps explain how different treponeme species/strains coexist and contribute to disease progression .

  • Potential therapeutic target: Lgt is essential for bacterial survival, making it a compelling antimicrobial target. Inhibition of Lgt leads to permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics, which could be exploited therapeutically .

  • Comparative biology: Different genetic lineages of T. denticola with potentially different Lgt properties coexist within the same patient, making comparative studies valuable .

What expression systems are most effective for producing recombinant T. denticola Lgt?

For successful expression of recombinant T. denticola Lgt, consider these methodological approaches:

  • E. coli-based expression: While E. coli is the most common expression system, membrane proteins like Lgt present challenges. Using E. coli strains specifically designed for membrane protein expression (such as C41(DE3), C43(DE3), or Lemo21(DE3)) typically yields better results.

  • Expression constructs: Including an N-terminal His-tag followed by a TEV protease cleavage site facilitates purification. The tag should be positioned to avoid interference with membrane insertion.

  • Induction conditions: For membrane proteins like Lgt, lower expression temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.4 mM) often improve proper folding and membrane insertion.

  • Detergent selection: Proper detergent selection is critical. Mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LMNG (lauryl maltose neopentyl glycol) are commonly used for extraction and purification of Lgt without denaturing the protein.

  • Validation: Expression should be verified by Western blotting using anti-His antibodies, and functionality can be assessed using biochemical assays measuring diacylglyceryl transferase activity .

What are the most effective methods for purifying recombinant T. denticola Lgt?

Purification of T. denticola Lgt requires specialized techniques for membrane proteins:

  • Membrane fraction preparation:

    • Harvest cells and disrupt by sonication or high-pressure homogenization

    • Remove unbroken cells and debris by centrifugation (10,000×g, 20 min, 4°C)

    • Isolate membranes by ultracentrifugation (100,000×g, 1h, 4°C)

    • Wash membrane pellet to remove peripheral proteins

  • Solubilization:

    • Resuspend membrane fraction in buffer containing 1-2% detergent (DDM or LMNG)

    • Incubate with gentle agitation for 1-2h at 4°C

    • Remove insoluble material by ultracentrifugation (100,000×g, 30 min, 4°C)

  • Affinity purification:

    • Apply solubilized fraction to Ni-NTA or TALON resin

    • Wash with buffer containing 20-40 mM imidazole and 0.05-0.1% detergent

    • Elute with buffer containing 250-300 mM imidazole and 0.05% detergent

  • Size exclusion chromatography:

    • Apply concentrated protein to a Superdex 200 column

    • Use buffer containing 0.05% detergent

    • Collect fractions corresponding to monomeric Lgt

  • Storage:

    • Concentrated protein (3-5 mg/ml) can be flash-frozen in liquid nitrogen

    • Addition of 10% glycerol improves stability during freezing

The purity should be >95% as assessed by SDS-PAGE, and the protein should remain stable and active for several months when stored properly at -80°C.

How can the enzymatic activity of recombinant T. denticola Lgt be measured in vitro?

Several approaches can be used to assess the enzymatic activity of recombinant T. denticola Lgt:

  • Glycerol phosphate release assay:
    This assay measures the release of glycerol phosphate, which is a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate .

    Protocol:

    • Prepare reaction mixture containing purified Lgt, phosphatidylglycerol, and a peptide substrate derived from a lipoprotein (e.g., Pal-IAAC, where C is the conserved cysteine)

    • Incubate at 30-37°C for 30-60 minutes

    • Detect released glycerol phosphate using a coupled luciferase reaction

    Note: When using phosphatidylglycerol with a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) may be released .

  • Mass spectrometry-based assay:
    This approach directly detects the modified peptide substrate.

    Protocol:

    • React purified Lgt with phosphatidylglycerol and peptide substrate

    • Terminate reaction with methanol/chloroform

    • Analyze reaction products by LC-MS/MS to detect peptides with added diacylglyceryl moiety

    Data analysis:

    • Look for a mass shift of approximately +576 Da (for a C16:0/C16:0 diacylglyceryl)

    • Confirm modification site using MS/MS fragmentation patterns

  • Fluorescence-based assay:
    Using fluorescently labeled peptide substrates provides a direct readout of activity.

    Protocol:

    • Synthesize peptide substrate with N-terminal FITC or similar fluorophore

    • Incubate with Lgt and phosphatidylglycerol

    • Monitor changes in fluorescence polarization or FRET

What mutation analysis techniques can reveal critical residues in T. denticola Lgt?

Based on structural studies of E. coli Lgt, several approaches can be used to identify and characterize critical residues in T. denticola Lgt:

  • Sequence alignment and homology modeling:

    • Align T. denticola Lgt sequence with structurally characterized E. coli Lgt

    • Identify conserved residues, particularly Arg143 and Arg239 which are essential for diacylglyceryl transfer in E. coli Lgt

    • Build homology models using crystallographic data from E. coli Lgt as a template

  • Site-directed mutagenesis:

    • Create alanine substitutions of conserved residues

    • For key arginines (homologous to E. coli Arg143 and Arg239), also create conservative substitutions (Lys)

    • Express and purify mutant proteins for activity assays

  • Functional complementation:

    • Create an inducible lgt deletion strain

    • Transform with plasmids expressing mutant variants of T. denticola Lgt

    • Monitor for rescue of growth defects under depletion conditions

  • In vitro activity assays:

    • Compare wild-type and mutant Lgt activity using the glycerol phosphate release assay

    • Determine kinetic parameters (Km, kcat) for each mutant

    • Assess substrate binding through differential scanning fluorimetry

Example data table from mutational analysis:

MutationRelative Activity (%)Km for PG (μM)Km for peptide (μM)Phenotype in complementation
Wild-type10015.3 ± 2.445.2 ± 5.1Full growth
R143A*<5NDNDNo growth
R143K*23.5 ± 4.242.6 ± 8.339.8 ± 4.2Partial growth
R239A*<5NDNDNo growth
H103A78.4 ± 6.122.7 ± 3.251.3 ± 6.4Full growth
D129A32.6 ± 3.868.4 ± 9.543.7 ± 5.8Reduced growth

*Residue numbers based on homology to E. coli Lgt; ND = Not Determined due to low activity

How does inhibition of T. denticola Lgt affect bacterial viability and virulence?

Inhibition of T. denticola Lgt has profound effects on bacterial physiology and virulence potential:

  • Membrane integrity: Lgt inhibition leads to permeabilization of the outer membrane, similar to what has been observed in E. coli, making bacteria more susceptible to antibiotics and serum killing .

  • Lipoprotein processing: When Lgt is inhibited, pro-lipoproteins accumulate in an unprocessed form (UPLP), affecting their proper localization and function. Unlike in LspA inhibition, this accumulation does not appear to be significantly linked to peptidoglycan .

  • Experimental approaches to study these effects:

    • Membrane permeability assays using fluorescent dyes (SYTOX Green, propidium iodide)

    • Antibiotic susceptibility testing using a panel of antibiotics with different mechanisms

    • Serum survival assays measuring bacterial viability after exposure to human serum

    • Biofilm formation assays to assess community behavior changes

    • Host cell adhesion and invasion assays to measure virulence effects

  • Unique aspects of T. denticola response: In polymicrobial biofilms typical of periodontal disease, Lgt inhibition may not only affect T. denticola directly but could disrupt interactions with other oral pathogens like P. gingivalis, potentially altering the pathogenic potential of the entire community .

  • Comparison with other lipoprotein processing inhibitors: Unlike inhibitors of later steps in lipoprotein processing (such as LspA inhibitors), deletion of the major outer membrane lipoprotein (lpp) does not provide resistance to Lgt inhibitors, suggesting a distinct inhibition mechanism that may be more robust against resistance development .

What are the structural aspects of T. denticola Lgt that can be targeted for inhibitor development?

Based on structural studies of E. coli Lgt and homology to T. denticola Lgt, several structural features can be targeted:

  • Phosphatidylglycerol binding site:

    • The E. coli Lgt crystal structure reveals a specific binding pocket for phosphatidylglycerol

    • Inhibitors targeting this highly conserved site may be effective against T. denticola Lgt

    • Small molecules that structurally mimic phosphatidylglycerol but cannot be processed as substrates represent potential inhibitors

  • Peptide substrate binding site:

    • The lipobox recognition site represents another potential target

    • Peptide-based inhibitors mimicking the lipobox sequence but containing non-hydrolyzable linkages could block substrate binding

  • Critical catalytic residues:

    • Targeting the catalytic machinery, particularly conserved arginine residues (corresponding to R143 and R239 in E. coli Lgt), which are essential for diacylglyceryl transfer

    • Structure-based design of inhibitors that form hydrogen bonds with these residues could prevent substrate binding or catalysis

  • Lateral access channels:

    • The mechanism proposed for E. coli Lgt suggests that substrates enter and products leave laterally relative to the lipid bilayer

    • Inhibitors that block these lateral channels could prevent substrate access

  • Identifying T. denticola-specific structural features:

    • Sequence alignment and homology modeling can identify unique regions in T. denticola Lgt

    • These regions could be targeted for selective inhibition without affecting host processes or beneficial bacteria

How can different genetic lineages of T. denticola Lgt be characterized in clinical samples?

Clinical studies have shown that individuals with periodontitis or gingivitis harbor multiple lineages of the same treponeme species within their oral cavities . To characterize these different genetic lineages of T. denticola Lgt:

  • PCR amplification and sequencing:

    • Design primers specific to conserved regions flanking the T. denticola lgt gene

    • Amplify lgt genes directly from subgingival plaque samples

    • Clone amplicons into plasmid vectors for sequencing

    • Compare sequences to identify variations

  • Phylogenetic analysis:

    • Align lgt sequences with reference strains

    • Construct phylogenetic trees to classify variants

    • Use appropriate evolutionary models for accurate branch length estimation

  • Functional characterization:

    • Express representative variants as recombinant proteins

    • Compare enzymatic properties using standardized activity assays

    • Evaluate substrate specificities using peptide libraries

  • Correlation with clinical parameters:

    • Track distribution of lgt variants across different disease states (health, gingivitis, periodontitis)

    • Correlate specific variants with clinical parameters (pocket depth, attachment loss)

    • Examine longitudinal changes during disease progression or treatment

  • Metagenomic approaches:

    • Use next-generation sequencing to profile the entire T. denticola population

    • Develop bioinformatic pipelines to identify and classify lgt variants

    • Determine relative abundance of different variants within the same sample

Example data from clinical sampling:

Clinical StatusNumber of T. denticola Lgt VariantsDominant Lgt VariantSecond Most AbundantCorrelation with Disease Severity
Healthy1-2Type A (80%)Type B (20%)N/A
Gingivitis2-3Type A (60%)Type C (30%)Moderate (r=0.45)
Mild Periodontitis3-4Type C (50%)Type D (30%)Strong (r=0.68)
Severe Periodontitis4-5Type D (45%)Type E (35%)Very strong (r=0.82)

How does T. denticola Lgt differ from Lgt in other oral pathogens?

Comparative analysis of Lgt across different oral pathogens reveals several important differences:

  • Sequence variation:

    • T. denticola Lgt shows approximately 30-40% sequence identity with Lgt from other major oral pathogens

    • Certain regions, particularly the substrate binding pocket, show higher conservation

    • The transmembrane topology may vary slightly between species

  • Substrate specificity:

    • While the core function of Lgt is conserved, substrate preferences may differ

    • T. denticola has a unique set of lipoproteins that may require specific recognition features

    • The lipobox sequences in T. denticola prelipoproteins may have subtle differences that influence Lgt interaction

  • Cellular localization and regulation:

    • The membrane organization in spirochetes like T. denticola differs from other gram-negative bacteria

    • This may affect how Lgt is positioned and regulated within the cell envelope

    • Response to environmental conditions (pH, oxygen, nutrient availability) may differ among species

  • Inhibitor sensitivity:

    • Small molecule inhibitors may show different efficacies against Lgt from different species

    • These differences could be exploited for selective targeting

  • Research approaches for comparative studies:

    • Recombinant expression of Lgt from multiple species

    • Side-by-side biochemical characterization

    • Cross-species complementation experiments

    • Structural biology studies to identify key differences

What are promising future research directions for T. denticola Lgt studies?

Several promising research directions could advance our understanding of T. denticola Lgt:

  • Structural biology:

    • Determination of T. denticola Lgt crystal structure to compare with E. coli Lgt

    • Cryo-EM studies to visualize Lgt in its native membrane environment

    • Molecular dynamics simulations to understand structural flexibility and substrate interactions

  • Systems biology:

    • Proteomics to identify the complete lipoprotein repertoire in T. denticola

    • Transcriptomics to understand regulation of lgt expression under different conditions

    • Interaction studies to map the network of proteins associated with Lgt

  • Host-pathogen interactions:

    • Investigation of how T. denticola lipoproteins interact with host immune receptors

    • Assessment of lipoproteins' role in immune evasion and persistence

    • Evaluation of lipoprotein-dependent biofilm formation in mixed oral communities

  • Therapeutic applications:

    • Development of T. denticola-specific Lgt inhibitors

    • Testing combination approaches targeting multiple lipoprotein processing steps

    • Investigation of Lgt inhibition as an adjunctive therapy for periodontal disease

  • Diagnostic applications:

    • Development of Lgt-based biomarkers for periodontal disease diagnosis

    • Creation of rapid tests to identify specific T. denticola strains based on Lgt variants

    • Correlation of Lgt variants with treatment outcomes

What technical challenges remain in studying recombinant T. denticola Lgt?

Several technical challenges need to be addressed for more comprehensive T. denticola Lgt research:

  • Protein expression and purification:

    • T. denticola proteins often have codon usage biases that complicate heterologous expression

    • Membrane proteins like Lgt are inherently difficult to express and purify in active form

    • Developing optimized protocols for high-yield, high-purity preparations remains challenging

  • Crystallization barriers:

    • Membrane proteins present significant crystallization challenges

    • Detergent selection, protein stability, and crystal packing issues must be overcome

    • Alternative approaches like lipidic cubic phase crystallization may be required

  • Functional assays:

    • Current assays for Lgt activity often have low throughput

    • Development of more sensitive, higher-throughput assays would accelerate research

    • Assays that work in complex biological samples would enable better clinical studies

  • Genetic manipulation:

    • T. denticola is less genetically tractable than model organisms like E. coli

    • Improved genetic tools for creating conditional mutants would advance functional studies

    • CRISPR-Cas systems adapted for T. denticola could transform genetic analyses

  • In vivo relevance:

    • Connecting in vitro findings to in vivo significance requires better animal models

    • The polymicrobial nature of periodontal disease complicates interpretation of single-species studies

    • Development of more representative biofilm models would improve translation of findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.