Recombinant Treponema pallidum CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA)

Shipped with Ice Packs
In Stock

Description

Biological Context of Treponema pallidum

Treponema pallidum is a microaerophilic, gram-negative spirochete bacterium with distinct subspecies that cause various human diseases, including syphilis, bejel, and yaws. This organism possesses a unique structure consisting of an outer membrane, peptidoglycan layer, inner membrane, protoplasmic cylinder, and periplasmic space . T. pallidum is characterized by high motility attributed to its helical shape and endoflagellum (periplasmic flagellum) . Unlike typical gram-negative bacteria, T. pallidum's outer membrane lacks lipopolysaccharide, contributing to its distinctive immunological properties and pathogenicity .

The metabolic capabilities of T. pallidum are notably limited due to the absence of both tricarboxylic acid cycle and oxidative phosphorylation processes . As a chemoorganoheterotroph and obligate parasite, T. pallidum acquires glucose from its host as its primary carbon source and relies on glycolytic mechanisms for ATP generation . This metabolic limitation underscores the significance of phospholipid biosynthesis enzymes like CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) for the organism's survival and virulence.

Membrane Structure and Function

T. pallidum's outer membrane exhibits remarkable properties that contribute to its stealth pathogenicity. The membrane contains few transmembrane proteins, which limits antigenicity and helps the bacterium evade host immune responses . The cytoplasmic membrane is covered in lipoproteins, while the outer membrane contains treponemal ligands primarily functioning in attachment to host cells . This unique membrane composition, which depends on proper phospholipid synthesis, plays a crucial role in the bacterium's persistence and immune evasion strategies.

Enzymatic Characteristics of CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

The enzyme CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) catalyzes a critical reaction in glycerophospholipid metabolism . The specific biochemical reaction involves:

CDP-diacylglycerol + sn-glycerol 3-phosphate → CMP + 3(3-sn-phosphatidyl)-sn-glycerol 1-phosphate

This reaction represents a key step in the biosynthesis of phosphatidylglycerol, an essential phospholipid component of bacterial membranes. The enzyme belongs to the family of transferases, specifically those that transfer non-standard substituted phosphate groups . In the context of T. pallidum metabolism, this enzymatic activity is particularly significant given the bacterium's limited metabolic capabilities and reliance on membrane integrity for survival within the host.

Substrate Specificity and Catalytic Mechanism

The CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase utilizes two primary substrates: CDP-diacylglycerol and sn-glycerol 3-phosphate . The reaction produces two products: CMP (cytidine monophosphate) and 3(3-sn-phosphatidyl)-sn-glycerol 1-phosphate, which is subsequently dephosphorylated to form phosphatidylglycerol . This enzyme's catalytic mechanism likely involves nucleophilic attack by the hydroxyl group of glycerol-3-phosphate on the phosphate group of CDP-diacylglycerol, resulting in the formation of a phosphodiester bond and the release of CMP.

Recombinant Production of T. pallidum pgsA

The production of recombinant T. pallidum proteins presents significant challenges due to the bacterium's inability to be cultured continuously in vitro. The approaches used for other T. pallidum enzymes may serve as a model for pgsA recombinant production. Based on protocols used for other T. pallidum proteins such as glycerophosphodiester phosphodiesterase (Gpd) and 3-phosphoglycerate mutase (Gpm), recombinant pgsA production likely involves several key steps.

Cloning and Expression Strategies

The gene encoding pgsA would typically be PCR amplified from T. pallidum genomic DNA using primers designed from the 5' and 3' ends of the coding region . Following PCR amplification, the product would be digested with appropriate restriction enzymes and ligated into an expression vector, such as pET series vectors that utilize the T7 promoter system . The construct would then be transformed into E. coli expression strains such as BL21(DE3) pLysS for protein production .

The expression of recombinant T. pallidum proteins in E. coli often results in the formation of inclusion bodies, as observed with other T. pallidum enzymes . Purification strategies would likely involve initial differential fractionation of transformed bacteria into soluble and insoluble fractions, followed by inclusion body purification and protein refolding if necessary .

Purification and Characterization

Purification of recombinant pgsA would typically employ techniques such as affinity chromatography, utilizing tags like hexahistidine motifs that can be incorporated at either the N-terminal or C-terminal end of the protein . The purification process would likely be monitored by SDS-PAGE analysis of bacterial lysates and fractions to verify expression and purity . Verification of the recombinant protein's identity could be performed through immunoblotting using specific antibodies raised against the recombinant protein .

Comparative Analysis with Homologous Enzymes

Table 1: Predicted Structural Features of T. pallidum pgsA Based on Homologous Enzymes

FeatureDescriptionFunctional Significance
Active SiteConserved residues for substrate bindingEssential for catalytic activity
CDP-binding DomainRecognition of CDP-diacylglycerolSubstrate specificity
Glycerol-3-phosphate Binding RegionInteraction with second substrateDetermines reaction specificity
Transmembrane DomainsMembrane associationLocalization within bacterial membrane
Catalytic CoreConserved among bacterial phosphatidyltransferasesEnzymatic mechanism

Metabolic Significance in T. pallidum

The metabolic capabilities of T. pallidum are notably restricted, with glucose serving as the primary carbon source acquired from the host . Given the absence of tricarboxylic acid cycle and oxidative phosphorylation, T. pallidum relies heavily on glycolysis for ATP generation . In this context, phospholipid biosynthesis becomes critical for maintaining membrane integrity and function.

Role in Membrane Phospholipid Synthesis

CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) catalyzes a key step in the biosynthesis of phosphatidylglycerol, which is an essential phospholipid in bacterial membranes . Given T. pallidum's unique outer membrane structure with few transmembrane proteins and low antigenicity, proper phospholipid composition is crucial for maintaining the stealth characteristics that allow the bacterium to evade host immune responses .

Potential Regulatory Mechanisms

Based on knowledge of other T. pallidum enzymes, potential regulatory mechanisms for pgsA might include transcriptional regulation similar to the Mn-dependent repressor system observed for the tro operon that includes the gpm gene . Another T. pallidum enzyme, 3-phosphoglycerate mutase (Gpm), is regulated by manganese through the Mn-dependent repressor TroR . Similar metal-dependent regulatory mechanisms might influence pgsA expression and activity, though direct evidence for this is not available in the search results.

Potential Applications in Research and Therapeutics

Recombinant T. pallidum pgsA has several potential applications in both research and therapeutic contexts, although specific developments in this area remain to be fully explored.

Diagnostic Applications

Antibodies raised against recombinant pgsA could potentially serve as tools for detecting T. pallidum in clinical samples, similar to approaches used with other T. pallidum proteins . The development of serological tests based on recombinant antigens could enhance specificity and sensitivity in syphilis diagnosis.

Therapeutic Target Potential

As an enzyme essential for membrane phospholipid synthesis, pgsA represents a potential therapeutic target for developing new antimicrobial agents against T. pallidum. Inhibitors of phospholipid biosynthesis could disrupt membrane integrity and function, potentially compromising the bacterium's survival and virulence.

Current Research Gaps and Future Directions

Despite the biological significance of CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase in T. pallidum, several important knowledge gaps remain to be addressed through future research.

Functional Validation in T. pallidum

Given the challenges of culturing T. pallidum in vitro, functional validation of pgsA's role in the bacterium's physiology and pathogenesis remains difficult. Development of innovative approaches for studying gene function in this organism, such as heterologous expression systems or surrogate hosts, would enhance our understanding of pgsA's biological significance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preferred format when placing your order, and we will strive to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. For dry ice shipping, please contact us in advance to arrange for an additional fee.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is finalized during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
pgsA; pgs; TP_0256; CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase; Phosphatidylglycerophosphate synthase; PGP synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
pgsA
Target Protein Sequence
MRLSDFYTALRLALVLPFFALYHMSRWVVMYFPAANVGRVVSIASVLLFLFIACTDFLDG YYARKSGKYSSFGKVFDPFADVIANVTVMLCLVADNFMPVFLFLCILYREFGMMFLRMLA CGEGHVVGAQRMGKLKTASYMGAVLFSLLLKALYAFELAGADWYERMRAVGRLVYVVPVV LALASFFSYLKTFFPILKRVCGRTRYPVCKTCREWD
Uniprot No.

Target Background

Function
This protein plays a critical role in the synthesis of acidic phospholipids by catalyzing the committed step in the pathway.
Database Links

KEGG: tpa:TP_0256

STRING: 243276.TP0256

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of pgsA in Treponema pallidum metabolism?

Treponema pallidum pgsA (TP_0256) functions as CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5), also known as phosphatidylglycerophosphate synthase. This enzyme plays a critical role in phospholipid biosynthesis, specifically in the formation of phosphatidylglycerol, an essential component of bacterial membranes. In T. pallidum, pgsA is particularly significant because the organism has limited biosynthetic capabilities due to its parasitic lifestyle. Genomic analysis has revealed that T. pallidum lacks certain enzymes for biosynthetic pathways necessary for cytoplasmic and outer membrane phospholipids, indicating an inherent requirement for phospholipids from the host . The pgsA enzyme helps T. pallidum utilize these acquired phospholipids for membrane biogenesis.

Which expression systems are most effective for producing recombinant T. pallidum pgsA?

Multiple expression systems have been successfully employed for recombinant production of T. pallidum pgsA:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, well-established protocols, cost-effectiveMay require optimization of codon usage for T. pallidum genes
YeastEukaryotic post-translational modificationsLonger production time than E. coli
BaculovirusSuitable for complex proteins, higher eukaryotic systemMore complex workflow, higher cost
Mammalian CellMost sophisticated post-translational modificationsHighest cost, longest production time

According to available information, E. coli appears to be the most commonly used system for T. pallidum recombinant proteins . When selecting an expression system, researchers should consider the intended application of the recombinant protein and whether native-like post-translational modifications are essential for their studies.

How can researchers verify the enzymatic activity of recombinant pgsA?

Verification of recombinant pgsA enzymatic activity can be accomplished through several complementary approaches:

  • Spectrophotometric assays: Measuring the conversion of substrates to products using coupled enzyme reactions that produce a spectrophotometric signal

  • Radiometric assays: Using radiolabeled substrates (typically 14C or 3H-labeled CDP-diacylglycerol) and measuring the formation of radiolabeled phosphatidylglycerophosphate

  • HPLC analysis: Separating and quantifying reaction substrates and products

  • Mass spectrometry: Detecting the specific mass changes associated with substrate conversion to product

  • Complementation studies: Testing whether the recombinant enzyme can restore function in pgsA-deficient bacterial strains

When establishing the assay, researchers should consider that optimal reaction conditions for T. pallidum enzymes may differ from those of model organisms, particularly regarding pH, temperature sensitivity, and cofactor requirements .

How does pgsA integrate into T. pallidum's unique energy conservation pathways?

Recent research suggests that T. pallidum utilizes a "flavin-centric" metabolic lifestyle with an acetogenic energy-conservation pathway that may involve phospholipid metabolism enzymes like pgsA. This acetogenic pathway catabolizes D-lactate, yielding acetate, reducing equivalents for maintaining chemiosmotic potential, and ATP .

The relationship between pgsA and this pathway can be understood through:

  • Membrane integrity maintenance: pgsA's role in phospholipid biosynthesis ensures proper membrane function, which is critical for maintaining proton gradients necessary for energy conservation

  • Potential redox balancing: Phospholipid metabolism may serve as an electron sink, helping to maintain cellular redox balance in the absence of conventional electron transport chains

  • Integration with glycerol-3-phosphate metabolism: Research has identified glycerol-3-phosphate dehydrogenase as an alternative electron sink in T. pallidum . Since pgsA utilizes glycerol-3-phosphate as a substrate, there may be coordinate regulation between these pathways

This alternative energy conservation mechanism helps explain how T. pallidum generates sufficient ATP despite lacking a Krebs cycle and oxidative phosphorylation capacity .

What experimental challenges exist in studying T. pallidum pgsA in its native context?

Studying T. pallidum pgsA in its native context presents several significant challenges:

ChallengeImpactCurrent Solutions
Inability to continuously culture T. pallidum in vitro until recentlyLimited availability of native materialUse of rabbit model for propagation; recent breakthrough in co-culture with mammalian cells
Fastidious growth requirementsDifficulty maintaining viable organismsSpecialized microaerophilic environment; co-culture with Sf1Ep cells
Low yield from culture systemsInsufficient material for extensive biochemical studiesRecombinant protein expression; genomic/transcriptomic approaches
Limited genetic manipulation toolsDifficulty in creating gene knockouts/modificationsRecent development of transformation methods for T. pallidum
Strain variationsDifferent physiological properties between Nichols-like and SS14-like strainsCareful strain selection; comparative studies

Recent breakthroughs in continuous in vitro cultivation of T. pallidum provide new opportunities for studying native pgsA, though throughput remains limited. The co-culture system with Sf1Ep cells allows bacterial growth with approximately 4-5 successive cell divisions over a one-week period, with about 50-60% of organisms associating with mammalian cells .

How can structural analysis of pgsA inform therapeutic development against T. pallidum?

Structural analysis of pgsA can significantly contribute to therapeutic development through several avenues:

  • Active site mapping: X-ray crystallography at high resolution (comparable to the 1.95 Å resolution achieved for TP0094 ) can reveal the precise configuration of the catalytic site, identifying potential targets for inhibitor design

  • Substrate binding pocket analysis: Understanding the molecular details of how pgsA binds CDP-diacylglycerol and glycerol-3-phosphate can inform the development of competitive inhibitors

  • Protein-protein interaction surfaces: If pgsA functions within a larger complex or has regulatory binding partners, identifying these interaction surfaces could present alternative inhibition strategies

  • Conformational dynamics: Techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can reveal dynamic regions of the protein that undergo conformational changes during catalysis

  • Comparative analysis with human enzymes: Structural differences between T. pallidum pgsA and human phospholipid biosynthesis enzymes can be exploited for selective targeting

Given that T. pallidum lacks certain biosynthetic capacities and relies on host-derived metabolites , enzymes like pgsA that interface between host-derived and bacterial metabolism represent particularly promising drug targets.

How does T. pallidum pgsA expression vary across different strain types and infection stages?

Recent proteomic analyses have provided insights into T. pallidum protein expression patterns across different strain types:

A 2024 study comparing the proteomes of the SS14 and Nichols strains detected approximately 61.5% of the total T. pallidum proteome, with generally similar protein expression profiles between the two strain types . While strain-specific differences in pgsA expression were not explicitly mentioned, the study did observe that:

  • Inter-strain amino acid sequence differences were primarily located within predicted surface-exposed regions in 16 known/putative outer membrane proteins

  • Proteins with unknown function comprised less than 10% of high-abundance proteins in both strains

  • Approximately 32.8% of T. pallidum proteins remained undetected in the proteomics analysis

Growth rate differences between strain types may indirectly affect pgsA expression, as Nichols-like strains (DAL-1) grew approximately 1.53 times faster than SS14-like strains (Philadelphia 1) both in vitro and in rabbit infection models . These growth differences suggest potential metabolic disparities that could involve phospholipid biosynthesis pathways.

The proteomics analyses to date have not specifically highlighted pgsA among the most abundant proteins , but its expression appears consistent with its role in maintaining essential membrane functions.

What methodologies can be used to study pgsA interactions with other components of T. pallidum metabolic pathways?

Several complementary methodologies can effectively explore pgsA interactions with other metabolic components:

  • Protein-protein interaction studies:

    • Pull-down assays using tagged recombinant pgsA

    • Bacterial two-hybrid systems

    • Crosslinking followed by mass spectrometry

    • Surface plasmon resonance (SPR) with potential interaction partners

  • Metabolic flux analysis:

    • Isotope labeling to track phospholipid precursors

    • Metabolomics to identify changes in intermediate concentrations when pgsA activity is altered

  • Systems biology approaches:

    • Integration with enzyme-constrained metabolic models like iTP251 and ec-iTP251, which have shown high predictive accuracy (MEMOTE score of 92%) and strong agreement with proteomics data (Pearson's correlation of 0.88) in central carbon pathways

    • Network analysis to identify functional modules containing pgsA

  • In vitro reconstitution:

    • Reconstitution of partial metabolic pathways using purified recombinant enzymes

    • Artificial membrane systems to study pgsA function in a membrane context

  • Genetic engineering approaches:

    • New transgenic T. pallidum strains using genomic loci (tp0009) that can accommodate insertions

    • Expression of fluorescently tagged pgsA to study localization and dynamics

These approaches can help determine whether pgsA functions as part of a larger metabolic complex and how its activity is regulated in response to changing environmental conditions or metabolic states.

What purification strategies are most effective for recombinant T. pallidum pgsA?

Effective purification strategies for recombinant T. pallidum pgsA include:

Purification MethodAdvantagesConsiderations
Immobilized Metal Affinity Chromatography (IMAC)High specificity for His-tagged constructsMay affect enzyme activity; tag cleavage may be required
Ion Exchange ChromatographyPreserves native protein structureBuffer optimization needed based on pI
Size Exclusion ChromatographySeparates different oligomeric statesLower resolution than other methods
Affinity Chromatography (substrate-based)Selects for properly folded proteinCustom affinity matrix may be required

A common approach is to use a hexahistidine tag at the amino-terminal end of the protein to simplify purification . This strategy has been successfully applied to other T. pallidum enzymes involved in the proposed acetogenic pathway, such as D-lactate dehydrogenase (TP0037) and phosphotransacetylase (TP0094) .

Typical purity assessment methods include:

  • SDS-PAGE (>95% purity target)

  • Measurement of optical density at 280 nm

  • Bradford assay for protein quantification

Buffer composition should be optimized based on stability testing, with common storage buffers including Tris-based buffer with 50% glycerol .

What specimen types are most suitable for detecting T. pallidum proteins in clinical samples?

For detection of T. pallidum proteins and DNA in clinical contexts, specimen selection significantly impacts success rates:

Specimen TypeDNA Extraction EfficiencyFull Molecular Typing EfficiencyNotes
Primary lesions83.0%80.9%Significantly higher yield than blood samples
Secondary lesionsHighHighGood source for molecular studies
Ear lobe bloodHighHighPromising alternative to primary lesions
Plasma28.2%43.1%Lower yield than tissue specimens
Whole bloodLowLowNot recommended as primary specimen
Cerebrospinal fluidLowLowMay be necessary for neurosyphilis studies

According to systematic review data, primary and secondary lesions and ear lobe blood specimens demonstrated significantly higher yields of T. pallidum DNA (83.0% vs. 28.2%, χ² = 247.6, p<0.001) and higher efficiency of full molecular typing (80.9% vs. 43.1%, χ² = 102.3, p<0.001) compared to plasma, whole blood, and cerebrospinal fluid .

While these findings focus on DNA detection, they have implications for protein studies as well, suggesting that lesion material would provide the best source for detecting native pgsA protein in clinical samples.

How can enzyme-constrained metabolic models help predict the role of pgsA in T. pallidum metabolism?

Enzyme-constrained metabolic models provide powerful frameworks for predicting the role of specific enzymes like pgsA in T. pallidum metabolism:

These models are particularly valuable for T. pallidum research because they can predict metabolic behaviors in experimental conditions that are challenging to achieve with this difficult-to-culture organism.

How might emerging genetic manipulation techniques advance studies of T. pallidum pgsA?

Recent breakthroughs in T. pallidum genetic manipulation open exciting possibilities for pgsA research:

  • Transformation capabilities: Recent work has demonstrated successful transformation of T. pallidum, potentially allowing for genetic modification of pgsA . Specifically, researchers have identified genomic loci (tp0009) that can accommodate insertions without affecting viability or pathogenicity.

  • Gene tagging approaches: The development of GFP-expressing T. pallidum strains suggests that similar approaches could be used to create fluorescently tagged pgsA for tracking protein localization and dynamics .

  • CRISPR-based modifications: Adaptation of CRISPR-Cas systems for T. pallidum could enable:

    • Precise modification of pgsA to study structure-function relationships

    • Creation of conditional knockdowns to assess pgsA essentiality

    • Introduction of regulatory elements to control pgsA expression

  • Reporter systems: Development of reporter constructs linked to pgsA promoters could help monitor expression under different conditions and in different tissues during infection.

  • Advanced imaging applications: Engineered strains could be used for correlative cryo-fluorescence and cryo-scanning electron microscopy, similar to approaches developed for Borrelia , allowing visualization of pgsA in the context of membrane architecture.

These techniques could transform our understanding of pgsA function by moving beyond recombinant systems to study the enzyme in its native context, potentially revealing previously unrecognized regulatory mechanisms or interaction partners.

What is the potential for pgsA as a target for novel antimicrobial development?

The potential of pgsA as an antimicrobial target can be evaluated through several considerations:

  • Target validation criteria:

    • Essentiality: While direct knockout studies in T. pallidum have been challenging, comparative genomics suggests pgsA is likely essential for membrane biogenesis

    • Conservation: pgsA is conserved across T. pallidum strains but has distinct features from human enzymes

    • Druggability: As an enzyme with defined catalytic activity, pgsA presents opportunities for inhibitor design

  • Potential inhibition strategies:

    • Competitive inhibitors of substrate binding

    • Allosteric inhibitors that disrupt protein dynamics

    • Covalent modifiers of catalytic residues

    • Disruptors of protein-protein interactions if pgsA functions in a complex

  • Advantages as a drug target:

    • T. pallidum's limited metabolic capabilities make it potentially more vulnerable to single-enzyme inhibition

    • The enzyme's role in phospholipid metabolism could create synergies with other antimicrobial mechanisms

    • Limited ability of T. pallidum to develop resistance due to its reduced genome and lack of horizontal gene transfer

  • Challenges to address:

    • Delivery of inhibitors to the relevant tissue compartments during infection

    • Potential for cross-reactivity with human phospholipid biosynthesis enzymes

    • Need for molecules that can penetrate T. pallidum's complex membrane structure

High-resolution structural data, combined with enzymatic characterization and metabolic modeling, would significantly advance the evaluation of pgsA as a therapeutic target.

How does pgsA activity correlate with T. pallidum strain virulence and tissue tropism?

The relationship between pgsA activity and T. pallidum strain characteristics could provide insights into pathogenesis mechanisms:

  • Strain variation observations:

    • Nichols-like strains (e.g., DAL-1) grow approximately 1.53 times faster than SS14-like strains (e.g., Philadelphia 1) both in vitro and in rabbit models

    • During co-infection experiments, DAL-1 consistently outgrew Philadelphia 1 regardless of inoculation ratio, suggesting competition for nutrients

    • These growth differences could be linked to variations in metabolic efficiency, potentially involving phospholipid biosynthesis pathways

  • Research approaches to explore correlation:

    • Comparative enzyme kinetics of pgsA from different T. pallidum strains

    • Analysis of membrane phospholipid composition across strains with different virulence profiles

    • Correlation of pgsA expression levels with tissue invasion capabilities

    • Examination of pgsA sequence variations in strains associated with different clinical manifestations (e.g., neurosyphilis)

  • Methodological considerations:

    • Use of recently developed in vitro culture systems to compare growth characteristics

    • Application of lipidomics to characterize strain-specific membrane compositions

    • Integration of findings with strain-typing data to identify patterns across clinical isolates

Understanding these relationships could help explain the diverse clinical presentations of syphilis and potentially identify markers for strains with enhanced virulence or specific tissue tropism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.