Recombinant Treponema pallidum DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Processes

FtsK is essential for chromosome segregation and cell division in T. pallidum. While specific studies on T. pallidum FtsK remain limited, its function aligns with conserved mechanisms observed in other bacteria:

FunctionMechanismRelevance to T. pallidum
DNA TranslocationTranslocates dsDNA at ~5,000 bp/s via ATP hydrolysis in the β subdomain .Coordinates chromosome movement during replication.
KOPS Bindingγ subdomain recognizes polarized KOPS motifs to direct translocation toward the dif site .Ensures proper chromosome positioning.
XerCD RecombinationActivates XerCD site-specific recombinases at the dif site to resolve chromosome dimers .Critical for post-replicative chromosome segregation.

Research Applications and Challenges

  1. Limited Functional Data: Most structural and mechanistic studies focus on E. coli FtsK .

  2. Domain-Specific Effects: Mutations in the γ subdomain disrupt KOPS binding but not translocation or XerCD activation .

  3. Reconstitution Requirements: Sensitive to freeze-thaw cycles; requires glycerol for stability .

Recombinant T. pallidum FtsK serves as a valuable tool for studying DNA translocation and chromosome segregation in spirochetes. While its structural and functional parallels to E. coli FtsK are well-established, further studies are needed to elucidate species-specific adaptations. Challenges include optimizing storage conditions and resolving domain-specific interactions in T. pallidum.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing it according to your specification.
Synonyms
ftsK; TP_0999; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-799
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
ftsK
Target Protein Sequence
MERSPLPRIIALTFGTLLFVSAVLLTLSTFLPLFTLHRASHWFFVPGTLLYETYAFSSLL VPLLLLHTALLLFVGGRSLRAESALVAFPLLFITAVCGEHGLYALRRALAARSISPSTRG GIDIVCVLCLLALLGAELYAALIYGERCYVWFHARIPRDFIADGFQDPSFPPSTADHPDT VSPPPAPSCATADVQTPEASAPPEGQFSTEVPLQGGEFLISEAEVQPATQVAACGGVSTP TALAPSVPSQAPFPLLPAPGLIQSNLPSDVHAPASPGSLPSVIPAQAPCVMALSPISAPS VAPAETLIPAQDDEQGPPRPIPASAAPLRHPCRGYQVPYDLLDQYSEDTYEGIDELTKNL ALLLEETFSEFNIRVEITGIKKGPVVTMFELLPPPGIKLSKITNLQDNVALKLAASSVRI VAPIPGKHAIGVEVPNKKRSLVTFKELLHTRTAGSNRMAIPVILGKDVTGEPQVIDLAQT PHLLIAGATGSGKSVCVNALILSILYHKCPDETKLLLIDPKIVELKLYNDIAHLLTPVIT EPKRALQALQYILCEMERRYALLEQLECRDIKTYNKKIQEKSIATQPLPFIVIIIDEFAD LMVASGKELETSVARLCAMSRAVGIHLVLATQRPSIDVITGLIKANIPSRIAFMVSSKMD SRIILDEMGAEKLLGRGDMLYMNPSQSFPTRIQGAYVSERELARVIAHVRAWGTPEYLDE EIFFDDDDASISGNFVDESDPLYEQAVQVVQYAGKASTSYVQRKLKIGYNRAARLIEEME ARGVVGPPNGSKPRDVLRS
Uniprot No.

Target Background

Function
Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus plays a crucial role in the assembly of the cell-division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site, located within the replication terminus region. It is required for activation of the Xer recombinase, enabling the activation of chromosome unlinking through recombination.
Database Links

KEGG: tpa:TP_0999

STRING: 243276.TP0999

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the FtsK DNA translocase and what is its role in Treponema pallidum?

FtsK is a DNA translocase enzyme that pumps double-stranded DNA directionally at approximately 5 kb/s. In bacterial systems, FtsK plays a crucial role in facilitating chromosome unlinking by activating XerCD site-specific recombination at the dif site, which is located in the replication terminus region of bacterial chromosomes . In Treponema pallidum, this mechanism is essential for proper chromosome segregation during cell division. The protein consists of multiple functional domains, with the γ regulatory subdomain specifically activating XerD catalytic activity to generate Holliday junction intermediates that can be subsequently resolved by XerC .

How does Treponema pallidum's genomic structure influence FtsK function?

Treponema pallidum has a relatively minimal genome with limited metabolic capacity, functioning as an obligate parasite that acquires glucose from its host . This genomic minimalism extends to its chromosome organization, where FtsK plays a critical role in managing DNA topology during replication. The bacterium's helical structure (6-15 μm long and 0.1-0.2 μm wide) and its unique cytoskeletal arrangement of cytoplasmic filaments that run the length of the cell create a distinct chromosomal architecture that FtsK must navigate . The complex membrane structure—consisting of an outer membrane, peptidoglycan layer, inner membrane, and periplasmic space—creates compartmentalization that influences how FtsK functions in chromosome segregation and cell division processes .

What are the structural features of Treponema pallidum FtsK that enable its function?

The FtsK protein from Treponema pallidum shares homologous domains with other bacterial FtsK proteins, including a DNA-binding domain, an ATP-binding domain for energy conversion, and a regulatory γ domain. The γ subdomain specifically interacts with XerD to activate recombination at dif sites . When expressed as a recombinant protein, the structure typically includes the conserved C-terminal domain responsible for DNA translocation and the γ regulatory subdomain that directly activates XerCD-dif recombination . This structural organization allows FtsK to function both as a molecular motor that moves DNA and as a regulatory protein that activates site-specific recombination.

How does the topological state of DNA influence FtsK activity in T. pallidum compared to other bacterial species?

The FtsK translocase operates as a directional DNA pump that must resolve complex topological states during chromosome segregation. Research indicates that FtsK translocation and activation of chromosome unlinking are coupled processes, with the translocation activity being essential for ensuring that recombination products are topologically unlinked . In Treponema pallidum, this process occurs within the constraints of a spiral-shaped cell with distinct cytoskeletal architecture . Experimental approaches to study this question would involve:

  • Comparison of topological requirements between recombinant T. pallidum FtsK and E. coli FtsK using in vitro DNA translocation assays

  • Analysis of DNA substrate preferences using various topologically constrained DNA molecules

  • Single-molecule techniques to visualize FtsK-mediated DNA translocation and resolution of topological conflicts

When the γ regulatory subdomain is separated from the translocase domain, it can still activate XerCD-dif recombination, but the resulting products are topologically complex and would impair chromosome unlinking . This suggests that the physical coupling of translocation and activation domains is critical for proper chromosome segregation.

What role does T. pallidum FtsK play in immune evasion strategies during infection?

T. pallidum is known for its ability to evade host immune defenses through multiple mechanisms, including its unique outer membrane structure with minimal surface protein expression . While FtsK primarily functions in chromosome segregation, understanding its potential contribution to immune evasion is relevant because:

  • FtsK-mediated chromosome organization may influence the expression patterns of virulence genes and antigenic variation systems

  • Any recombinant T. pallidum protein, including FtsK, could potentially serve as a diagnostic antigen or vaccine candidate

Research methodologies to address this question would include:

  • Comparative expression analysis of FtsK during different stages of infection

  • Antibody detection assays similar to those used for TpN17, TpN47, and TpN44.5 antigens

  • Assessment of FtsK domain immunogenicity compared to known immunogenic lipoproteins

  • Investigation of potential interactions between FtsK and the Treponema repeat (Tpr) family of proteins involved in antigenic variation

How do the subspecies-specific genetic variations in T. pallidum affect FtsK function across different clinical manifestations?

T. pallidum consists of three subspecies (T. p. pallidum, T. p. endemicum, and T. p. pertenue) causing distinct clinical conditions (syphilis, bejel, and yaws, respectively) . These subspecies can be differentiated genetically using restriction fragment length polymorphism (RFLP) analysis . Research questions regarding subspecies variations in FtsK would involve:

  • Sequence analysis of the FtsK gene across subspecies to identify conserved and variable regions

  • Functional characterization of recombinant FtsK proteins from each subspecies

  • Correlation between FtsK genetic variations and disease manifestation patterns

  • Investigation of potential subspecies-specific interactions between FtsK and XerCD recombination machinery

Understanding these variations could provide insights into the different tissue tropism and disease progression patterns observed across T. pallidum subspecies.

What are the optimal conditions for expressing recombinant T. pallidum FtsK in heterologous systems?

Based on successful recombinant expression approaches for T. pallidum antigens, the following methodology is recommended:

Expression System Design:

  • PCR amplification of the FtsK gene or specific functional domains from T. pallidum genomic DNA

  • Insertion into an E. coli expression vector with an N-terminal hexahistidine tag to facilitate purification

  • Transformation into an appropriate E. coli strain optimized for recombinant protein expression

Expression Optimization Table:

ParameterRecommended ConditionsConsiderations
E. coli strainBL21(DE3) or Rosetta™Rosetta strain provides rare codons that may be present in T. pallidum
Induction0.5-1.0 mM IPTGLower temperatures (16-25°C) may improve folding
Growth mediumLB or 2XYT with appropriate antibioticsRich media improves yield
PurificationNi-NTA affinity chromatographyMetal chelate affinity chromatography using the His-tag
Buffer conditions50 mM Tris-HCl, 300 mM NaCl, pH 8.0Include 10% glycerol for stability

The recombinant protein should be verified by SDS-PAGE, Western blot analysis, and functional assays to confirm DNA translocation activity and XerCD activation capacity.

How can one design functional assays to measure the DNA translocation activity of recombinant T. pallidum FtsK?

In Vitro Translocation Assay Methodology:

  • DNA Substrate Preparation:

    • Linear DNA fragments containing dif site sequences

    • Circular plasmids with strategically placed dif sites

    • Fluorescently labeled DNA for real-time visualization

  • Assay Components:

    • Purified recombinant T. pallidum FtsK (full-length or functional domains)

    • Purified XerC and XerD recombinases

    • ATP or ATP regeneration system

    • Buffer system optimized for DNA binding and ATP hydrolysis

  • Detection Methods:

    • Gel-based assays to monitor DNA translocation and recombination products

    • Fluorescence-based real-time assays for kinetic analysis

    • Single-molecule techniques to visualize individual translocation events

  • Controls:

    • ATP-binding site mutants to confirm ATP dependence

    • γ-domain deletions to assess XerCD activation specificity

    • Comparison with E. coli FtsK as a reference standard

The translocation rate of approximately 5 kb/s observed with other FtsK proteins provides a benchmark for evaluating T. pallidum FtsK activity.

What techniques are most effective for determining the interaction between T. pallidum FtsK and the XerCD-dif recombination system?

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation:

    • Use antibodies against recombinant FtsK to pull down associated XerC/XerD proteins

    • Western blot analysis to detect interaction partners

  • Surface Plasmon Resonance (SPR):

    • Immobilize recombinant FtsK on a sensor chip

    • Measure binding kinetics with purified XerC and XerD proteins

    • Determine association/dissociation constants

  • Bacterial Two-Hybrid System:

    • Create fusion constructs of FtsK domains with reporter protein fragments

    • Co-express with XerC/XerD fusions to detect interactions in vivo

DNA-Protein Interaction Analysis:

  • Electrophoretic Mobility Shift Assays (EMSA):

    • Use labeled dif site DNA fragments

    • Detect shifts in mobility upon binding of FtsK and/or XerCD

  • DNase I Footprinting:

    • Identify specific DNA regions protected by FtsK binding

  • ChIP-Seq Analysis:

    • Map genome-wide binding sites of FtsK in T. pallidum

These methods collectively provide comprehensive characterization of the molecular interactions underlying FtsK-mediated XerCD-dif recombination activation.

How should researchers interpret discrepancies between in vitro and in vivo FtsK activity data?

When analyzing FtsK function, researchers frequently encounter differences between controlled in vitro experiments and observations in biological systems. A methodological approach to resolving these discrepancies includes:

  • Systematic Comparison Analysis:

    • Create a detailed table comparing parameters between in vitro and in vivo systems

    • Identify specific variables that differ (e.g., DNA topology, protein concentrations, cellular compartmentalization)

  • Reconstitution Experiments:

    • Gradually increase system complexity from purified components toward cellular conditions

    • Add individual cellular factors to in vitro systems to identify which components reconcile the observed differences

  • Domain-specific Analysis:

    • Separately evaluate translocation activity and XerCD activation functions

    • Determine if discrepancies are specific to particular functional domains

  • Microscopic Validation:

    • Use fluorescently tagged FtsK in cellular systems to correlate localization with activity

    • Compare with in vitro single-molecule observations

The observation that isolated γ subdomain can activate XerCD-dif recombination but produces topologically complex products exemplifies how in vitro activity may not recapitulate the biologically relevant function requiring coordinated translocation and activation.

What statistical approaches are most appropriate for analyzing sequence conservation of FtsK across Treponema species and subspecies?

To analyze FtsK sequence conservation across Treponema variants, researchers should employ:

  • Multiple Sequence Alignment (MSA):

    • Align FtsK sequences from all available Treponema species and subspecies

    • Use algorithms like MUSCLE or CLUSTAL for accurate alignment

  • Conservation Analysis:

    • Calculate per-residue conservation scores

    • Generate conservation heat maps highlighting functional domains

  • Phylogenetic Analysis:

    • Construct maximum-likelihood trees using RAxML-NG with appropriate substitution models

    • Apply bootstrap replication (minimum 500 replicates) to assess branch reliability

  • Domain-Specific Conservation:

    • Compare conservation rates between functional domains (N-terminal, linker, C-terminal translocase, and γ regulatory domains)

    • Correlate with known structure-function relationships

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Map selection patterns to functional domains

These approaches should be integrated with existing phylogenetic data from genes like tprK, tRNA-Ile, tRNA-Ala intergenic spacers, and tprD that have been used to construct T. pallidum phylogenetic trees .

How can researchers distinguish between direct and indirect effects of FtsK on T. pallidum pathogenesis in experimental models?

Determining causality in complex biological systems requires rigorous experimental design:

  • Genetic Manipulation Approaches:

    • Create FtsK domain-specific mutants (where technically feasible)

    • Employ conditional expression systems to control FtsK activity temporally

    • Use heterologous expression in related organisms as proxy systems

  • Multi-omics Integration:

    • Correlate FtsK activity with transcriptomic, proteomic, and phenotypic changes

    • Perform network analysis to map direct and indirect interaction pathways

  • Temporal Resolution Studies:

    • Track the sequence of molecular events following FtsK activation/inhibition

    • Establish causality through time-course experiments

  • Biochemical Validation:

    • Confirm direct protein-protein or protein-DNA interactions through in vitro reconstitution

    • Validate observed interactions in cellular contexts

  • Control Experiments:

    • Use structurally similar but functionally distinct proteins as controls

    • Design experiments that specifically isolate FtsK-dependent effects

Given T. pallidum's limited genetic tractability as an obligate parasite with minimal metabolism , researchers often need to employ surrogate systems and computational approaches to complement direct experimental evidence.

What are the major technical challenges in producing functional recombinant T. pallidum FtsK, and how can they be addressed?

Technical Challenges and Solutions Table:

ChallengeDescriptionMethodological Solutions
Protein solubilityLarge multi-domain proteins often form inclusion bodies- Express individual functional domains separately
- Use solubility-enhancing fusion partners (MBP, SUMO)
- Optimize expression conditions (temperature, induction)
Functional integrityMaintaining ATP-dependent motor activity in recombinant form- Include appropriate cofactors during purification
- Verify activity through multiple assays
- Compare with known active FtsK proteins from model organisms
Specific activityLower specific activity compared to native protein- Optimize buffer conditions for stability and activity
- Remove inhibitory contaminants through additional purification steps
- Assess oligomerization state (active FtsK forms hexamers)
Post-translational modificationsPotential modifications in native T. pallidum absent in E. coli- Express in alternative systems with similar modification patterns
- Identify and characterize any modifications in native protein
Structural validationConfirming proper folding of recombinant protein- Circular dichroism spectroscopy
- Limited proteolysis assays
- Activity-based validation

Researchers can draw upon successful approaches used for other T. pallidum recombinant proteins such as the highly immunogenic lipoproteins TpN17, TpN47, and TpN44.5, which showed high antibody titers when expressed as recombinant proteins .

How might recombinant T. pallidum FtsK be utilized in diagnostic or therapeutic applications for treponemal diseases?

Potential Research Applications:

  • Diagnostic Development:

    • Serological assays using recombinant FtsK domains as antigens

    • Evaluation of FtsK-specific antibody responses across different stages of infection

    • Comparative analysis with existing diagnostic antigens (TpN17, TpN47, TpN44.5)

  • Therapeutic Target Exploration:

    • Structure-based design of selective FtsK inhibitors

    • Assessment of FtsK inhibition on T. pallidum viability

    • Comparison with conventional antibiotic approaches (e.g., penicillin-G)

  • Vaccine Research:

    • Evaluation of FtsK domains as potential vaccine candidates

    • Analysis of immune responses against conserved FtsK epitopes

    • Challenges posed by T. pallidum's immune evasion strategies

While T. pallidum can be effectively treated with antibiotics like penicillin-G , exploring alternative molecular targets like FtsK could address cases of antibiotic resistance or treatment failures. The methodological approach would involve screening for compounds that specifically inhibit T. pallidum FtsK without affecting human cellular functions, followed by validation in appropriate model systems.

What novel research directions could emerge from integrating FtsK studies with T. pallidum's unique antigenic variation mechanisms?

T. pallidum employs sophisticated antigenic variation mechanisms, particularly through the Treponema repeat family of proteins (Tpr) . Integrating FtsK research with these mechanisms could lead to several innovative research directions:

  • Recombination Mechanism Integration:

    • Investigate potential mechanistic overlap between FtsK-XerCD recombination and Tpr gene conversion

    • Determine if FtsK-mediated DNA translocation influences antigenic variation frequency or patterns

  • Chromosomal Organization Effects:

    • Map the three-dimensional organization of T. pallidum chromosome with focus on FtsK binding sites and Tpr gene loci

    • Analyze whether chromosome topology influences access to donor sequences for TprK variation

  • Evolution of DNA Processing Systems:

    • Comparative analysis of DNA translocase systems across pathogenic and non-pathogenic Treponema species

    • Correlation between FtsK diversity and antigenic variation capabilities

  • Systems Biology Approaches:

    • Develop integrated models of chromosome management and antigenic variation

    • Identify potential regulatory networks connecting these processes

  • Therapeutic Strategy Development:

    • Evaluate whether targeting FtsK could indirectly modulate antigenic variation rates

    • Design approaches to simultaneously target multiple DNA processing systems

This integrated approach could provide fundamental insights into how basic chromosomal maintenance processes like FtsK-mediated DNA translocation may influence pathogen evolution and host-pathogen interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.