Recombinant Treponema pallidum Flagellar biosynthetic protein flhB (flhB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
flhB; TP_0715; Flagellar biosynthetic protein FlhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-376
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
flhB
Target Protein Sequence
MIEQEGTFPLPLFIIDLQWFAAEDEGRSEDPTETKLRKAREEGRVPKSQDLNGAFVMLFT STSLFLLAPFILRECIGVLRFFFTRATTASIQNTGWFFVFVRYFMKLALPISFVALVSGV AANIVQNKTVLFSVKSIRPQFKKISPDVIRFFKRSFFSTEGLFNLLKSLIKITAIFFVSY FTIRNDLFMFVSLLGVSLTQSIFYITSLAGKVLLEVSLLLVVFSLPDYFFQRRQFIDSLK MSRQEVKEELKEQEGDPLVRSYVRKQMQSLVRESARNTTDADVVITNPTHFAVAVQYEPA YMTAPTVVAKGSDGTAYRIKRLAKEAGILIEENKPLARALYTQVAIGREVPYEYFNALVL IFTKLDKFKTHAQRKR
Uniprot No.

Target Background

Function
Essential for the formation of the rod structure in the basal body of the flagellar apparatus. Together with FliI and FliH, it may constitute the export apparatus for flagellin.
Database Links

KEGG: tpa:TP_0715

STRING: 243276.TP0715

Protein Families
Type III secretion exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of FlhB in Treponema pallidum?

FlhB serves as an integral component of the flagellar export apparatus in Treponema pallidum, facilitating the transport of flagellar proteins from the cytoplasm to the periplasmic space for assembly of the complex flagellar structure. The protein belongs to a conserved family of flagellar biosynthetic proteins that show significant homology across bacterial species, suggesting evolutionary conservation of this essential motility mechanism . Unlike highly expressed flagellar filament proteins such as FlaB1, FlaB2, FlaB3, and FlaA, the FlhB protein is expressed at relatively low levels during infection, as demonstrated by transcriptome analyses . This differential expression pattern reflects the distinct roles of structural components versus assembly machinery components in the flagellar system. The proper functioning of FlhB is likely critical for T. pallidum motility, which is essential for the pathogen's ability to disseminate within host tissues and establish infection.

How does the expression of flhB compare to other flagellar genes in T. pallidum?

Transcriptome analysis of T. pallidum during infection has revealed striking differences in expression levels among flagellar genes, with flhB showing notably lower expression compared to genes encoding flagellar filament proteins. The gene exhibits transcription levels significantly below the average for T. pallidum genes, in contrast to the exceptionally high expression observed for genes encoding the flagellar filament core proteins (flaB1, flaB2, flaB3) and outer layer protein (flaA) . For context, flagellin genes such as flaB3 showed a cDNA/DNA signal ratio of 25.9, while biosynthetic flagellar genes including flhB had ratios placing them among the lowest transcribed genes . This expression pattern is consistent with the regulatory hierarchy of flagellar gene expression observed in other bacteria, where components of the export apparatus are needed in smaller quantities than the abundant structural proteins. The low transcription levels of flhB suggest tight regulation of the flagellar export apparatus during the infection process, potentially reflecting the specific temporal requirements for this protein during flagellar assembly.

What structural features characterize the FlhB protein?

The FlhB protein in T. pallidum contains conserved domains characteristic of flagellar export apparatus proteins, including transmembrane regions that anchor it within the cytoplasmic membrane and cytoplasmic domains involved in substrate recognition. While specific structural data for T. pallidum FlhB is limited, homology with other bacterial FlhB proteins suggests it likely undergoes auto-cleavage events important for regulating substrate specificity during flagellar assembly . The protein interacts with other components of the flagellar export apparatus, including FliQ, FliR, and FlhA, forming a complex that functions as a gateway for the export of flagellar proteins . Studies of bacterial motility protein networks have identified numerous interaction partners for flagellar export apparatus proteins, indicating that FlhB functions within a complex protein interaction network . Understanding these structural features is crucial for elucidating the mechanism by which FlhB facilitates the selective transport of flagellar proteins during the ordered assembly process.

What challenges exist in expressing recombinant T. pallidum FlhB?

Expressing recombinant T. pallidum FlhB presents several technical challenges stemming from both its membrane-associated nature and the unique biological characteristics of treponemal proteins. Membrane proteins like FlhB typically contain hydrophobic domains that can lead to protein aggregation, misfolding, and toxicity when overexpressed in heterologous systems such as E. coli . Researchers must carefully optimize expression conditions, including temperature, inducer concentration, and host strain selection, to maximize the yield of correctly folded protein. The codon usage bias in T. pallidum differs significantly from that of common expression hosts, potentially necessitating codon optimization of the flhB sequence or use of specialized strains supplying rare tRNAs . Additionally, the potential presence of cysteine residues that form disulfide bonds in the native protein may require expression systems that facilitate proper disulfide bond formation. Expression strategies that have proven successful for other T. pallidum proteins, such as fusion with solubility-enhancing tags and expression as truncated soluble domains, may be adapted for FlhB recombinant production .

How can protein-protein interaction studies illuminate FlhB function?

Comprehensive protein-protein interaction studies represent a powerful approach to understanding FlhB's functional role within the complex flagellar export machinery of T. pallidum. Techniques such as bacterial two-hybrid systems, co-immunoprecipitation, and crosslinking studies can reveal direct interaction partners of FlhB, including other components of the export apparatus (FliQ, FliR, FlhA) and potential substrate proteins . Such interaction networks provide insight into the assembly sequence and regulatory mechanisms controlling flagellar biosynthesis in this difficult-to-cultivate pathogen. Previous studies examining bacterial motility protein networks have successfully identified novel components of flagellar systems by screening proteomes of small bacteria, including T. pallidum, revealing unexpected interactions that expanded understanding of flagellar assembly . Quantitative approaches like surface plasmon resonance or isothermal titration calorimetry can further characterize the kinetics and thermodynamics of these interactions, providing mechanistic insight into substrate recognition and export. Validation of interactions identified in heterologous systems through site-directed mutagenesis of putative interaction interfaces can confirm their biological relevance and identify critical residues for FlhB function.

What is the relationship between FlhB expression and flagellar glycosylation in T. pallidum?

The potential relationship between FlhB function and the glycosylation status of flagellar proteins in T. pallidum represents an intriguing but underexplored research area. Glycosylation of flagellar core proteins (FlaBs) has been detected in T. pallidum and related oral treponemes, suggesting this post-translational modification plays an important role in flagellar structure or function . As a component of the flagellar export apparatus, FlhB may influence the export of flagellar proteins carrying glycosylation signals or interact differently with glycosylated versus non-glycosylated substrates. Comparative studies of nonmotile treponeme strains lacking detectable FlaB proteins with strains exhibiting altered motility and flagellar protein profiles could reveal correlations between FlhB expression, flagellar protein glycosylation, and motility phenotypes . The spontaneous low-motility variant of T. vincentii-related strain RitzA (OMZ 305A), which lacks FlaA and displays altered FlaB banding patterns, provides a useful model for investigating such relationships . Understanding whether FlhB expression levels or functionality correlates with the glycosylation state of flagellar proteins could provide insight into the coordinated regulation of flagellar assembly and post-translational modifications.

What methodological approaches can overcome the limitations of studying FlhB in the uncultivatable T. pallidum?

The obligate parasitism of T. pallidum presents unique challenges for studying proteins like FlhB, necessitating creative methodological workarounds to understand its function and regulation. Heterologous expression systems using related cultivable spirochetes such as Treponema denticola or Borrelia burgdorferi may allow functional complementation studies to assess FlhB activity in a more native context than E. coli-based systems . Comparative genomics and transcriptomics approaches leveraging RNA extracted from T. pallidum during rabbit infection can provide valuable insights into flhB expression patterns across infection stages without requiring in vitro cultivation . The microarray analysis technique utilized in previous studies, where gene expression was measured with the cDNA/DNA signal ratio as a proxy for transcriptional activity, can be applied to study flhB regulation under different infection conditions . Advanced imaging techniques like cryo-electron tomography of T. pallidum cells extracted from infected rabbit tissue may visualize the assembled flagellar export apparatus and localize FlhB within this complex. Additionally, synthetic biology approaches could reconstruct portions of the T. pallidum flagellar export system in heterologous hosts to study component interactions and functional requirements.

What expression systems are optimal for recombinant T. pallidum FlhB production?

Several expression systems have shown promise for the production of recombinant T. pallidum proteins, though each presents unique advantages and limitations when applied to membrane-associated proteins like FlhB. The E. coli pET expression system has been successfully used for other T. pallidum proteins, such as TpF1, which was expressed as a His-tagged protein in E. coli BL21(DE3) and purified to >95% purity using Ni-NTA affinity chromatography . For membrane proteins like FlhB, specialized E. coli strains such as C41(DE3) or C43(DE3), derived from BL21(DE3) and optimized for membrane protein expression, may improve yield and solubility. Expression as a fusion protein with tags that enhance solubility (MBP, SUMO, or TrxA) may facilitate proper folding and reduce aggregation of recombinant FlhB. Alternative expression systems, including cell-free protein synthesis, which bypasses potential toxicity issues, or yeast-based systems that provide a eukaryotic membrane environment, merit exploration for difficult-to-express proteins. Expression conditions require careful optimization, with reduced temperatures (16-20°C), lower inducer concentrations, and extended induction periods typically favoring proper folding of complex membrane proteins over higher yield of misfolded product.

What purification strategies are effective for recombinant FlhB?

Purification of recombinant FlhB requires strategies tailored to its transmembrane nature and potentially complex folding requirements. For full-length FlhB, detergent-based extraction from membranes using mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) preserves protein structure while solubilizing the membrane-embedded regions. The purification protocol would typically include an initial solubilization step followed by affinity chromatography using the affinity tag incorporated in the recombinant construct, similar to the approach used for TpF1 where the His-tagged protein was purified using Ni-NTA beads . An alternative approach involves expressing only the soluble cytoplasmic domain of FlhB, which eliminates the challenges associated with membrane protein purification while still providing material for functional and structural studies of this critical region. Size exclusion chromatography serves as an essential polishing step to separate monomeric protein from aggregates and remove detergent micelles when working with full-length protein. Quality control using methods such as SDS-PAGE, Western blotting with anti-His monoclonal antibodies (for His-tagged constructs), and mass spectrometry can confirm identity and purity similar to the validation performed for recombinant TpF1 .

What methods are appropriate for functional characterization of recombinant FlhB?

Functional characterization of recombinant FlhB requires a multi-faceted approach targeting its role in the flagellar export apparatus. In vitro protein-protein interaction assays, including pull-down experiments with other components of the flagellar export system (FliQ, FliR, FlhA), can identify direct binding partners and the domains involved in these interactions. To assess FlhB's potential autoproteolytic activity, which is critical for function in other bacterial species, in vitro cleavage assays employing site-directed mutagenesis of the putative cleavage site can determine whether T. pallidum FlhB undergoes similar processing . Liposome reconstitution assays, where purified FlhB is incorporated into artificial membrane vesicles, may provide insights into its membrane topology and potential channel-forming capabilities. Complementation studies in flhB mutants of cultivable spirochetes or other bacteria can test the functional conservation of this protein across species by determining whether the T. pallidum protein can rescue motility defects. Structural studies using X-ray crystallography or cryo-electron microscopy, particularly of the cytoplasmic domain, would provide valuable insights into substrate recognition surfaces and conformational changes associated with function.

How can recombinant FlhB be used to generate specific antibodies for research applications?

Development of FlhB-specific antibodies represents a valuable application of recombinant protein technology for studying this protein in its native context. Purified recombinant FlhB or selected peptides representing unique epitopes can be used to immunize rabbits or mice following standardized protocols similar to those used for other T. pallidum proteins. When designing immunization strategies, researchers should consider whether to use full-length protein, which presents challenges due to its membrane-embedded regions, or focus on the cytoplasmic domain, which is likely more immunogenic and accessible in the native protein. The resulting antisera can be validated for specificity using Western blot analysis against recombinant FlhB and T. pallidum lysates, following approaches similar to those used for TpF1, where antibody reactivity was confirmed using both recombinant protein and infected rabbit sera . Monoclonal antibodies developed against specific domains of FlhB would be particularly valuable for studying its localization, processing, and interaction partners in the native context. These antibodies enable applications such as immunofluorescence microscopy to visualize FlhB localization in T. pallidum cells, immunoprecipitation to identify interaction partners, and development of detection assays for functional studies.

How does FlhB contribute to T. pallidum pathogenesis and immune evasion?

The contribution of FlhB to T. pallidum pathogenesis extends beyond its direct role in flagellar assembly to potential impacts on immune recognition and tissue invasion. By facilitating proper assembly of the periplasmic flagella, which are shielded from host immune detection by the outer membrane, FlhB indirectly contributes to the immune evasion strategy of this pathogen. The low expression levels of flhB observed during infection may represent a regulatory strategy to control flagellar assembly and motility in response to environmental cues within the host . Investigation of flhB expression across different infection stages and tissue environments could reveal whether its regulation correlates with changes in T. pallidum dissemination capacity or immune recognition patterns. The expression levels of flhB compared to genes encoding flagellar filament proteins suggests a precise stoichiometric regulation of flagellar components that may be critical for optimal motility and pathogenesis . Understanding how FlhB function might be modulated by host-derived factors or environmental conditions could provide insights into the adaptation mechanisms of T. pallidum during its complex multi-stage infection process.

What can comparative studies across Treponema species reveal about FlhB evolution and specialization?

Comparative analysis of FlhB across different Treponema species offers valuable insights into the evolution and functional specialization of this protein in diverse host environments. T. pallidum subspecies causing venereal syphilis, endemic syphilis, and yaws, along with related species like T. denticola and T. vincentii, represent a natural evolutionary experiment in adaptation to different tissue niches and host species. Sequence analysis of flhB genes across these species could identify conserved functional domains versus variable regions that might correlate with specific adaptive traits. Experimental comparisons could include expression analysis of flhB orthologs in cultivable treponemes under various environmental conditions to identify regulatory differences . Functional studies comparing FlhB from pathogenic and non-pathogenic treponemes, particularly focusing on protein-protein interactions with conserved flagellar components, might reveal species-specific adaptation of the flagellar export system. The observation that flagellar glycosylation occurs across various Treponema species raises questions about whether FlhB function in the export apparatus has co-evolved with changes in substrate modification patterns . Such comparative approaches could elucidate how evolution of this flagellar export component has contributed to the remarkable host adaptation strategies of pathogenic treponemes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.