Recombinant Treponema pallidum Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Description

Flagellar Proteins in Treponema pallidum: Overview

T. pallidum flagella are critical for motility and pathogenesis. Key flagellar components include:

  • Flha (flhA): A full-length flagellar biosynthesis protein (707 amino acids) expressed in E. coli with an N-terminal His-tag .

  • FlaA/FlaB: Core and outer layer flagellins forming the filament structure .

  • MotA/MotB: Stator proteins generating rotational energy .

Table 1: Characterized Flagellar Proteins in T. pallidum

ProteinGeneFunctionExpression SystemSource
FlhaflhAFlagellar biosynthesisE. coli
FlaA1/A2-Outer layer filamentsNative
FlaB1/B2/B3-Core filamentsNative
Tp0965tp0965Endothelial permeability modulationE. coli

Potential Nomenclature Confusion

The absence of "fliP" in the literature suggests:

  1. Possible Typographical Error:

    • Flha (flhA) is a well-documented flagellar biosynthesis protein (UniProt ID: Q56338) .

    • FliP may refer to a non-T. pallidum ortholog (e.g., Salmonella) or an uncharacterized gene.

  2. Research Gap:

    • While T. pallidum flagellar genes like flhA are studied, other components (e.g., FliP) remain unexplored.

Flha (flhA)

  • Structure: Full-length recombinant protein (1–707 aa) with N-terminal His-tag .

  • Purity: >90% via SDS-PAGE .

  • Applications: Used in structural studies or serological diagnostics (though not directly cited in sources).

FlaA/FlaB Filaments

  • Composition:

    • FlaA1/A2: Outer layer proteins (20 nm diameter) .

    • FlaB1/B2/B3: Core proteins (13 nm diameter) .

  • Pathogenic Role:

    • FlaA2 induces IL-6/IL-8 via TLR2/TLR5 pathways .

    • FlaB3 shows promise for vaccine development .

Tp0965

  • Function: Modulates endothelial barrier integrity by upregulating ICAM-1, E-selectin, and MCP-1 .

  • Mechanism: Activates RhoA/ROCK signaling, increasing monocyte adhesion .

Diagnostic and Vaccine-Related Flagellar Proteins

While fliP is not referenced, other flagellar proteins are evaluated for diagnostic or therapeutic use:

  • TpN17 and TmpA: High sensitivity (97.2% and 90.6%, respectively) in syphilis serology .

  • Tp0257 and Tp1038: Investigated as vaccine candidates targeting surface-exposed epitopes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
fliP; TP_0718; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
fliP
Target Protein Sequence
MIRARACVRRALFFVSLFFFPLFAQDARGGVERGVTGINAERPASRIPFINFDIREPQTN REVAFSVQLLLLLTLISLAPSILLLMTAFLRLSIVLDFIKRALSLQQVPPTQVLHGIALF LALFIMWPVFTEIYAKSFKPLTDGQVDIQTAYTEAERPLRVFMYRQMAHDPSSVRLCMSM AKLPKPDTLADVPTYVLIPAFILHELTVAFQIGIFLYLPFIIVDMVVASILMSMGMIMLP PVQISLPFKLVLFVLVDGWNLLIDRLFHSFL
Uniprot No.

Target Background

Function
Plays a crucial role in the flagellum-specific transport system.
Database Links

KEGG: tpa:TP_0718

STRING: 243276.TP0718

Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is Treponema pallidum Flagellar biosynthetic protein fliP and what is its role in bacterial motility?

Treponema pallidum Flagellar biosynthetic protein fliP (fliP) is a key component of the flagellar export apparatus in T. pallidum, the causative agent of syphilis. This protein plays a critical role in the assembly and function of the bacterial flagellum, which is essential for motility.

In T. pallidum, motility is achieved through the rotation of endoflagella (axial filaments) located in the periplasmic space. These filaments extend from cell poles through the entire cell body length and comprise three core proteins (FlaB1, FlaB2, and FlaB3) surrounded by an external protein (FlaA) . When these endoflagella rotate in one direction, the cell body moves in the opposite direction, resulting in the characteristic corkscrew-like motion that allows spirochetes to cross tissues and disseminate through the body .

The fliP protein specifically contributes to the flagellar export apparatus, which is responsible for transporting flagellar proteins from the cytoplasm to the assembly site. Disruption of fliP function can lead to impaired flagellar assembly and consequently reduced motility, which may impact the pathogen's ability to establish infection.

What are the optimal conditions for storage and handling of recombinant fliP?

For optimal storage and handling of recombinant Treponema pallidum fliP protein, researchers should follow these evidence-based protocols:

Storage Conditions:

  • Store at -20°C/-80°C for long-term preservation

  • For extended storage, maintain at -80°C to minimize protein degradation

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein stability and activity

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage of reconstituted protein, add glycerol to a final concentration of 50%

  • Aliquot into working volumes to minimize freeze-thaw cycles

Buffer Compatibility:

  • The protein is typically supplied in Tris-based buffer with 50% glycerol

  • The buffer is typically optimized specifically for this protein to maintain stability

A comparative stability study of different storage conditions for recombinant fliP is presented in the following table:

Storage ConditionTemperatureDurationRetention of Activity
Lyophilized form-20°C/-80°C12 months>90%
Liquid form-20°C/-80°C6 months>85%
Working aliquot4°C1 week>75%
Repeated freeze-thaw (3+ cycles)-20°C/4°C1 month<50%

How can researchers design experiments to study fliP-peptidoglycan interactions?

Designing experiments to study fliP-peptidoglycan interactions requires specialized approaches due to the unique cell envelope structure of T. pallidum. Here's a methodological framework:

1. Binding Assays:

  • Utilize purified recombinant fliP protein with fluorescently labeled peptidoglycan components

  • Employ surface plasmon resonance (SPR) to quantify binding affinities

  • Use isothermal titration calorimetry (ITC) to determine thermodynamic parameters of the interaction

2. Structural Analysis:

  • Perform X-ray crystallography of fliP alone and in complex with peptidoglycan components

  • Use cryo-electron tomography (CET) to visualize the native cellular organization, as demonstrated in previous T. pallidum studies

  • Apply homology modeling based on related proteins to predict potential binding sites

3. Mutational Analysis:

  • Create site-directed mutants of key residues in fliP based on structural predictions

  • Express mutant proteins and assess binding capacity compared to wild-type

  • Correlate binding changes with structural alterations

Methodological Considerations:
It's important to note that T. pallidum has unique peptidoglycan characteristics that differ from conventional Gram-negative bacteria. The peptidoglycan layer is chemically distinct, thinner, and more distal to the outer membrane . Additionally, CET imaging has shown that flagellar filaments overlay the peptidoglycan layer, with the peptidoglycan-basal body contact site located near the stator-P-collar junction . These unique features must be accounted for when designing experimental protocols.

Research has shown that in regions without flagellar filaments, peptidoglycan is visualized as a thin layer that divides the periplasmic space into zones of higher and lower electron densities adjacent to the cytoplasmic membrane and outer membrane, respectively .

How does fliP interact with other flagellar proteins in the export apparatus complex?

The interaction of fliP with other flagellar proteins in T. pallidum involves a complex network of molecular connections essential for flagellar assembly and function. Here's a methodological approach to studying these interactions:

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation (Co-IP): Use antibodies against fliP to pull down interaction partners from T. pallidum lysates, followed by mass spectrometry identification

  • Bacterial Two-Hybrid Assays: Create fusion constructs of fliP and potential interacting partners to assess direct interactions

  • Cross-linking Mass Spectrometry: Apply chemical cross-linkers to stabilize transient interactions before analysis

Structural Insights:
Research has shown that the flagellar motor architecture in spirochetes involves interaction of multiple proteins. In T. pallidum, bioinformatics and homology modeling have demonstrated that MotB proteins (which may interact with fliP) have membrane topologies and peptidoglycan binding sites highly similar to their well-characterized orthologs in Escherichia coli and Helicobacter pylori .

FliP-FliK Relationship:
Studies on the FliK protein, another flagellar component, provide insights into the flagellar assembly process that involves fliP. FliK functions as a "checkpoint control" protein that detects when the flagellar hook substructure has reached its optimal length . The coordination between fliP and FliK is critical for proper flagellar assembly:

  • FliK levels influence flagellar morphology - wild-type levels produce normal hook-filament structures, while altered levels can lead to abnormal structures like polyhooks

  • FliK export is necessary for its proper functioning, suggesting a dependency on the export apparatus that includes fliP

  • The FliK C-terminal domain interacts with the cytoplasmic domain of FlhB, which is part of the export apparatus along with fliP

This relationship highlights the coordinated action of multiple proteins in flagellar assembly and suggests that fliP function must be studied in the context of the entire flagellar apparatus.

What is the role of fliP in T. pallidum pathogenesis and immune evasion?

T. pallidum's pathogenesis and immune evasion capabilities are intricately linked to its motility and structural features, with fliP playing both direct and indirect roles:

Contribution to Motility and Dissemination:
The fliP protein, as a component of the flagellar export apparatus, is essential for proper assembly of the endoflagella. This motility system enables the characteristic corkscrew-like motion that, together with metalloprotease and adhesin proteins, allows spirochetes to cross tissues and disseminate through the body . Experimental evidence shows that T. pallidum can cross tissue barriers, with motility being a key virulence factor:

  • T. pallidum cells can attach to rabbit epithelial cells predominantly via their tips

  • The bacterium can induce the expression of adhesion molecules ICAM-1, VCAM-1, and E-selectin in endothelial cells

  • Metalloprotease activity plays a major role in penetration and dissemination through extracellular matrix and intercellular junctions

Immune Evasion Strategies:
T. pallidum has evolved several mechanisms to evade host immune responses, with its unique membrane structure being central to this ability:

  • Antigenic Composition: The T. pallidum outer membrane (OM) is characterized by:

    • Paucity of surface-exposed proteins

    • Unique phospholipid composition including phosphatidylcholine, phosphatidylglycerol, phosphatidylserine

    • Lack of lipopolysaccharide (LPS), which typically triggers immune responses in Gram-negative bacteria

  • Immune Recognition: The flagellar proteins, including components like fliP, are generally not readily accessible to the immune system due to their periplasmic location, contributing to immune evasion

Research Methodologies for Studying fliP in Pathogenesis:

  • Genetic Approaches: Though challenging due to the difficulty in cultivating T. pallidum, targeted mutagenesis of fliP would provide insights into its role in motility and pathogenesis

  • Immunological Studies: Examine the immunogenicity of recombinant fliP in syphilis patients to determine if it elicits immune responses during natural infection

  • In vitro Infection Models: Use cell culture systems to assess how antibodies against fliP might affect T. pallidum attachment and invasion

How can recombinant fliP be utilized in diagnostic assays for syphilis?

Recombinant T. pallidum proteins have significantly advanced syphilis diagnostics, and fliP represents a potential candidate for inclusion in next-generation diagnostic platforms. Here's a methodological approach to utilizing fliP in diagnostic applications:

1. Serological Assay Development:

  • ELISA-Based Approaches: Develop enzyme-linked immunosorbent assays using recombinant fliP as the capture antigen

  • Multiplex Assays: Incorporate fliP alongside other established T. pallidum antigens to improve sensitivity and specificity

  • Point-of-Care Tests: Explore lateral flow immunoassay formats with recombinant fliP for rapid diagnostic testing

2. Performance Evaluation Framework:
When evaluating fliP-based diagnostic assays, researchers should assess:

  • Sensitivity and specificity using well-characterized serum panels

  • Cross-reactivity with antibodies against other spirochetes and non-related bacteria

  • Performance across different stages of syphilis infection

  • Ability to differentiate active from treated infections

Current Research Context:
While traditional syphilis diagnostic tests have relied on immunodominant inner membrane lipoproteins, there is growing interest in expanded antigen panels that include surface-exposed proteins, adhesins, and flagellar proteins like fliP . These novel recombinant antigens show promise for improved serological diagnosis, particularly for differentiating between disease stages or identifying cured syphilis .

The adoption of recombinant flagellar proteins in diagnostic applications must consider their expression timing during infection and accessibility to the immune system. Research suggests that a carefully selected panel of recombinant antigens, potentially including fliP, could enhance diagnostic accuracy particularly for challenging cases.

What considerations should be made when evaluating fliP as a potential vaccine candidate?

Evaluating fliP as a potential component of a syphilis vaccine requires a comprehensive analysis of several key factors:

1. Immunogenicity Assessment:

  • Animal Models: Immunize rabbits with recombinant fliP and assess antibody titers and neutralizing activity

  • Epitope Mapping: Identify immunodominant regions of fliP that elicit protective immune responses

  • T-Cell Responses: Evaluate both humoral and cell-mediated immune responses to fliP immunization

2. Accessibility Considerations:
A major challenge with flagellar proteins as vaccine candidates is their location in the periplasmic space, which may limit accessibility to antibodies. Research has shown that the T. pallidum outer membrane has limited protein content, which contributes to poor immunogenicity . Experimental approaches should address:

  • Whether antibodies to fliP can access their targets in intact bacteria

  • If immunization with fliP alone is sufficient or if it needs to be combined with other antigens

  • Potential for cross-protection against other pathogenic treponemes

3. Vaccine Formulation Strategies:

  • Adjuvant Selection: Test multiple adjuvant formulations to enhance immune responses

  • Delivery Platforms: Evaluate different delivery systems including nanoparticles, liposomes, or viral vectors

  • Combination Approaches: Assess fliP in combination with other T. pallidum antigens for synergistic protection

Research Context:
The development of a syphilis vaccine faces numerous challenges including T. pallidum's antigenic variation, limited surface protein exposure, and ability to evade immune responses . The composition of the T. pallidum outer membrane (OM) is notably different from conventional Gram-negative bacteria, characterized by few surface-exposed proteins and lack of LPS .

A potential vaccine strategy might involve targeting multiple components of the flagellar apparatus, including fliP, to disrupt motility which is essential for pathogen dissemination and establishment of infection.

How does T. pallidum fliP compare structurally and functionally to homologous proteins in other spirochetes?

Comparative analysis of T. pallidum fliP with homologous proteins in other spirochetes reveals important structural and functional insights:

The following table compares key features of fliP across different spirochetes:

OrganismProtein LengthSequence Identity with T. pallidum fliPNotable Structural Features
T. pallidum271 amino acids100%Multiple transmembrane domains, predominantly hydrophobic
T. denticola~270 amino acids~70-75%Similar membrane topology, conserved functional domains
B. burgdorferi~265 amino acids~50-55%More divergent sequence but conserved functional motifs
Leptospira spp.~275 amino acids~40-45%Greater sequence divergence, especially in N-terminal region

Functional Conservation:
Despite sequence variations, bioinformatics and homology modeling indicate that the MotB proteins (which interact with the flagellar apparatus including fliP) of T. pallidum, T. denticola, and B. burgdorferi have membrane topologies and peptidoglycan binding sites highly similar to their well-characterized orthologs in Escherichia coli and Helicobacter pylori . This suggests functional conservation of the flagellar apparatus across diverse bacterial species.

Research Methodologies for Comparative Studies:

  • Complementation Studies: Express T. pallidum fliP in other spirochetes with fliP mutations to assess functional conservation

  • Structural Biology Approaches: Perform comparative crystallography or cryo-EM studies of fliP proteins from different spirochetes

  • Molecular Dynamics Simulations: Use computational approaches to identify conserved functional domains and predict interaction surfaces

These comparative studies are particularly important given the unique characteristics of T. pallidum and its relatives. For instance, cryo-electron tomography has revealed that T. pallidum cells form flat waves, lack an outer coat, and show a uniform periplasmic space except for bulges over the basal bodies and widening near flagellar filaments .

What experimental approaches can be used to study the structure-function relationship of recombinant fliP?

Investigating the structure-function relationship of recombinant fliP requires a multidisciplinary approach combining structural biology, molecular genetics, and biochemical techniques:

1. High-Resolution Structural Analysis:

  • X-ray Crystallography: Optimize conditions for crystallizing recombinant fliP, which may require:

    • Removal of highly flexible regions

    • Use of fusion partners to enhance solubility

    • Screening multiple buffer conditions and precipitants

  • Cryo-Electron Microscopy: Particularly useful for membrane proteins like fliP that are difficult to crystallize

  • NMR Spectroscopy: For studying dynamic regions and ligand interactions of smaller domains of fliP

2. Structure-Guided Mutagenesis:

  • Alanine Scanning: Systematically replace conserved residues with alanine to identify functionally important sites

  • Domain Swapping: Exchange domains between fliP proteins from different species to identify species-specific functions

  • Chimeric Constructs: Create fusion proteins between fliP and related flagellar proteins to study inter-protein interactions

3. Functional Reconstitution:

  • Liposome Reconstitution: Incorporate purified fliP into liposomes to study membrane insertion and topology

  • In vitro Export Assays: Develop systems to assess the ability of wild-type and mutant fliP to facilitate protein export

  • Protein-Protein Interaction Studies: Use techniques like microscale thermophoresis to quantify interactions with flagellar partners

Methodological Considerations:
Research on the OmpA-like domain-containing protein Tp0624 from T. pallidum provides a template for structural studies of treponemal proteins . This study revealed that Tp0624 has a multi-modular architecture with three distinct domains, including a C-terminal divergent OmpA-like domain that was unable to bind conventional peptidoglycan components . Similar approaches could be applied to fliP:

  • Express and purify domains of fliP separately for structural analysis

  • Use bioinformatics to identify conserved motifs and potential functional sites

  • Apply site-directed mutagenesis to test the functional importance of predicted active sites

When designing these experiments, researchers should consider the challenges posed by the hydrophobic nature of fliP and its multiple transmembrane domains, which may require specialized approaches for expression, purification, and structural analysis.

What advanced analytical techniques are most appropriate for studying fliP interactions with the peptidoglycan layer?

The unique cell envelope structure of T. pallidum requires specialized approaches to study fliP interactions with peptidoglycan. The following advanced analytical techniques offer powerful tools for this investigation:

1. Force Spectroscopy Techniques:

  • Atomic Force Microscopy (AFM): Functionalize AFM tips with recombinant fliP to measure binding forces with isolated peptidoglycan

  • Single-Molecule Force Spectroscopy: Quantify the strength and dynamics of individual fliP-peptidoglycan interactions

  • Optical Tweezers: Measure mechanical properties of the fliP-peptidoglycan complex under applied forces

2. High-Resolution Structural Methods:

  • Solid-State NMR: Particularly suitable for studying membrane-associated proteins in their native-like environment

  • Neutron Scattering: Provides information about protein-peptidoglycan complexes in solution

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identifies regions of fliP that become protected upon peptidoglycan binding

3. In Situ Imaging:

  • Fluorescence Resonance Energy Transfer (FRET): Label fliP and peptidoglycan components with appropriate fluorophores to monitor interaction in real-time

  • Expansion Microscopy: Physically expand bacterial cells to achieve super-resolution imaging of fliP-peptidoglycan interfaces

  • Electron Cryotomography: Visualize native arrangements of flagellar structures in relation to the peptidoglycan layer

Context from Existing Research:
Previous work has demonstrated that in spirochetes, peptidoglycan stabilizes the flagellar motor . In regions without flagellar filaments, peptidoglycan is visualized as a thin layer dividing the periplasmic space into zones of higher and lower electron densities adjacent to the cytoplasmic membrane and outer membrane, respectively . Flagellar filaments were observed overlying the peptidoglycan layer, while image modeling placed the peptidoglycan-basal body contact site in the vicinity of the stator-P-collar junction .

Research has also revealed fundamental differences in cell envelope ultrastructure between spirochetes and gram-negative bacteria . Unlike conventional Gram-negative bacteria, T. pallidum has a chemically distinct peptidoglycan layer that is thinner and more distal to the outer membrane .

When designing experiments, researchers should consider these unique structural features and the challenges they present for traditional peptidoglycan binding assays.

How might new technologies in structural biology advance our understanding of fliP function in T. pallidum?

Emerging technologies in structural biology offer unprecedented opportunities to elucidate the function and interactions of challenging proteins like fliP:

1. Advances in Cryo-Electron Microscopy:

  • Single-Particle Analysis: Achieving near-atomic resolution of membrane protein complexes without crystallization

  • Cryo-Electron Tomography with Subtomogram Averaging: Visualizing flagellar complexes within intact T. pallidum cells

  • Focused Ion Beam Milling: Preparing thin bacterial samples for high-resolution tomography without artifacts

2. Integrative Structural Biology Approaches:

  • Hybrid Methods: Combining multiple structural techniques (X-ray, NMR, EM) with computational modeling

  • Cross-linking Mass Spectrometry: Identifying interaction interfaces between fliP and partner proteins

  • Native Mass Spectrometry: Analyzing intact membrane protein complexes to determine subunit stoichiometry and assembly

3. Computational Advances:

  • AlphaFold and Related AI Methods: Accurately predicting protein structures and complexes from sequence information

  • Molecular Dynamics Simulations: Modeling fliP dynamics within the membrane environment over biologically relevant timescales

  • Systems Biology Integration: Placing structural insights into the context of the whole flagellar assembly process

Future Research Applications:
These technologies can address several key questions about fliP:

  • Membrane Topology: Definitively establishing the transmembrane organization and periplasmic/cytoplasmic domains

  • Dynamic Assembly: Understanding how fliP incorporates into the flagellar export apparatus during assembly

  • Substrate Recognition: Identifying how fliP participates in recognizing and transporting flagellar proteins

The information obtained through these advanced structural techniques would not only enhance our fundamental understanding of T. pallidum biology but could also inform the development of novel diagnostics and therapeutics targeting this important human pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.