Recombinant Treponema pallidum Flagellar biosynthetic protein fliR (fliR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will prioritize developing the specified tag type if you have specific requirements. Please inform us of your desired tag type.
Synonyms
fliR; TP_0716; Flagellar biosynthetic protein FliR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
fliR
Target Protein Sequence
MERSFDALFSQASLFFLAAVRVFALMFTVPLLSVRSVSRVVRVALAGLIAFLVLPLAYPA PMQVREFSAYYVLLLLGEGLLGILTGFFISVIFTTFSAAGQFFSYQMGFGTSEMYDTFAQ IENPLMGQFLNFVAMLVFLQIKGFQILFLGGVLRSFQAVNCFVFLRKQEALLLFFTKALS ALFLHAMTIALPIMGALLLIHVSMGLLTKAAPQMNLLSEGLPLTIVVTFVLLSVILPYMI NLFVSILFGGFEMFEQLLVKLGKAL
Uniprot No.

Target Background

Function
This protein plays a role in flagellar biosynthesis.
Database Links

KEGG: tpa:TP_0716

STRING: 243276.TP0716

Protein Families
FliR/MopE/SpaR family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the role of fliR in Treponema pallidum and how is it organized genetically?

The fliR protein in T. pallidum is part of a newly described protein family involved in the biogenesis and assembly of flagella and the control of flagellar rotation. It is encoded within what has been designated as the "fla operon" consisting of six open reading frames (ORFs): fliM', fliY, fliP, fliQ, fliR, and flhB' . This operon is contained within a 5-kb treponemal DNA insert that was identified through TnphoA mutagenesis of a T. pallidum genomic DNA library . Based on homology studies, these proteins likely play critical roles in flagellar assembly, which is essential for the characteristic corkscrew motility of spirochetes that contributes to tissue penetration during infection.

How does fliR conservation compare across bacterial species?

The fliR protein has significant homology with proteins found in other bacterial species including Escherichia coli, Salmonella typhimurium, and Bacillus subtilis . This evolutionary conservation suggests fundamental importance in bacterial motility systems. In certain species like Yersinia, Salmonella typhimurium, and Shigella flexneri, homologs of these flagellar proteins are also involved in the export of virulence factors , indicating a potential dual role in both motility and pathogenesis that could be relevant to T. pallidum infection biology.

What expression systems are most effective for producing recombinant T. pallidum proteins including fliR?

Based on successful approaches with other T. pallidum proteins, Escherichia coli expression systems have proven effective for recombinant protein production. When expressing T. pallidum proteins like TpF1, researchers have used E. coli to produce His-tagged fusion proteins that maintain immunoreactivity with sera from infected individuals . For membrane proteins like fliR, specialized E. coli strains designed for membrane protein expression would be recommended. Expression strategies should include optimization of induction conditions, consideration of fusion tags for purification, and careful evaluation of protein solubility and functionality after purification.

What methodologies are appropriate for studying fliR expression patterns in T. pallidum?

RNA-seq and quantitative RT-PCR have been successfully applied to study gene expression in T. pallidum under different conditions. Previous transcriptome analyses have identified gene expression profiles in T. pallidum, highlighting highly expressed genes including those for lipoproteins, chaperonins, and proteins involved in redox balance and chemotaxis . For fliR specifically, researchers should:

  • Use RNA-seq to compare expression across different growth conditions

  • Perform RT-qPCR for validation of expression levels, as demonstrated in previous T. pallidum studies

  • Consider analysis of coordinated expression with other flagellar genes

  • Correlate expression with motility phenotypes

How should researchers design experiments to assess fliR's role in T. pallidum motility?

Due to the difficulty of direct genetic manipulation in T. pallidum, multiple complementary approaches are recommended:

  • Compare fliR expression between in vitro and in vivo growth conditions using RNA-seq, as demonstrated in previous studies

  • Correlate fliR expression with observed motility phenotypes

  • Utilize heterologous expression in more genetically tractable spirochetes

  • Develop antisera against recombinant fliR for immunolocalization studies

  • Apply the newly developed continuous culture system to study motility under defined conditions

Recent comparison of T. pallidum gene expression in vitro versus in rabbit infection showed that certain genes have significantly different expression levels (up to 8-fold) between these environments . Researchers should determine if fliR is among these differentially regulated genes to understand its context-dependent expression.

What should be considered when analyzing transcriptional data related to fliR and other flagellar genes?

When analyzing transcriptional data:

  • Determine whether fliR expression correlates with other flagellar genes, particularly those in the same operon

  • Compare expression levels to known highly expressed genes such as those encoding lipoproteins, which have been identified in previous studies

  • Consider that T. pallidum has been shown to have relatively low levels of transcriptional regulation due to its reduced genome

  • Be aware that genes for chemotaxis proteins (cheX, cheY, mcp2-1, and cheA) have been found to be highly expressed in T. pallidum , which may be functionally related to flagellar genes

AntigenPearson Correlation CoefficientSignificance Level
Tp07680.57***
Tp08590.50***
Tp04350.45***
Tp01630.44***
Tp09540.41***
Tp05740.39***
Tp07690.34***
Tp10380.32***
Tp1031/TprL0.32***
Tp0117/TprC0.31***

Table 1: Correlation coefficients between various T. pallidum antigens, demonstrating the approach for analyzing relationships between bacterial proteins. Similar analysis could be applied to understand fliR relationships with other proteins.

How should researchers evaluate the immunogenicity of recombinant fliR?

When evaluating immunogenicity:

  • Test reactivity with sera from rabbits experimentally infected with T. pallidum, as performed with TpF1

  • Compare reactivity at different time points post-infection (e.g., 30, 60, and 120 days)

  • Generate specific anti-fliR antisera through immunization protocols

  • Assess cross-reactivity with sera from individuals with other spirochetal diseases

  • Determine antibody persistence following treatment

Studies with the T. pallidum protein TpF1 demonstrated strong immunoreactivity with sera collected 30, 60, and 120 days after infection, while no reactions were observed with sera from uninfected rabbits . Similar approaches could determine fliR's immunogenic profile.

What controls are essential when assessing fliR as a potential diagnostic antigen?

Critical controls should include:

  • Sera from uninfected individuals to establish specificity baseline

  • Sera from patients with potentially cross-reactive infections (Lyme disease, leptospirosis)

  • Stage-specific sera (primary, secondary, latent, and congenital syphilis)

  • Comparison with established T. pallidum diagnostic antigens such as Tp0435/TpN17, Tp0574/TpN47, and Tp0171/TpN15

  • Correlation with results from standard tests like RPR, VDRL, and TPPA

Previous research with TpF1 showed 100% specificity with sera from uninfected controls and individuals with potentially cross-reactive infections , setting a benchmark for new diagnostic antigens.

How can researchers reconcile differences in fliR expression data between in vitro and in vivo conditions?

When interpreting differential expression:

  • Consider that T. pallidum gene expression shows remarkable similarity between in vitro culture and rabbit infection, with only 94 genes (9%) showing significant differences

  • Evaluate whether differences reflect adaptation to specific environments or technical variability

  • Correlate expression differences with phenotypic changes

  • Analyze the entire flagellar apparatus to identify coordinated regulation patterns

  • Consider protein-level validation through proteomic approaches

It's important to note that genes with higher transcript levels during rabbit infection included those encoding ribosomal proteins, membrane proteins, glycolysis enzymes, and proteins associated with solute transport , suggesting these represent adaptations to the host environment.

What approaches help distinguish between direct and indirect effects when studying flagellar protein functions?

To distinguish direct from indirect effects:

  • Compare expression patterns across multiple flagellar genes (fliM', fliY, fliP, fliQ, fliR, and flhB')

  • Examine relationships between flagellar gene expression and motility

  • Correlate with expression of genes known to be involved in chemotaxis (cheX, cheY, mcp2-1, and cheA)

  • Analyze expression timing during infection progression

  • Consider the functional relationships between flagellar structure and other virulence mechanisms

Previous studies have shown that in T. pallidum, genes encoding chemotaxis proteins and enzymes of the glycolytic pathway are highly expressed , suggesting integrated regulation of metabolism, motility, and virulence.

How might fliR research contribute to understanding T. pallidum pathogenesis?

The potential contributions include:

  • Elucidating the relationship between motility and tissue invasion capabilities

  • Understanding how flagellar assembly impacts immune evasion

  • Identifying potential targets for motility inhibition as a therapeutic approach

  • Exploring evolutionary adaptation of flagellar systems in the context of obligate parasitism

  • Determining whether fliR and other flagellar proteins could serve as vaccine candidates

The fact that certain members of the flagellar protein family are also involved in the export of virulence factors in other bacterial species raises intriguing questions about potential dual functions in T. pallidum.

What methodological innovations would advance fliR research?

Key methodological advances would include:

  • Optimization of the recently developed continuous culture system for T. pallidum

  • Development of genetic manipulation techniques suitable for T. pallidum

  • Advances in structural biology approaches for membrane proteins

  • Improved animal models for studying T. pallidum in vivo

  • Development of high-throughput screening methods for flagellar inhibitors

The recent breakthrough in continuous cultivation of T. pallidum represents a significant advance that will enable more sophisticated studies of flagellar proteins like fliR under controlled laboratory conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.