Recombinant Treponema pallidum Flagellar protein FliL (fliL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
fliL; TP_0722; Flagellar protein FliL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
fliL
Target Protein Sequence
MAEKDSIGDIADDFEEQLVAPAADRVGFLPGLLRWVAIAVGAVIFIVTVVTATALVLAKQ GSSHTAYPVSQEFRESRELLQYYESVGLIRTNTADALPGTVVVSVALGYPLNDKTAQQEL SARLVELKDFLRSYFQRKTLSELRPEHEQKVKIEIRNEINDNVLSRSKVKDIRFTQFDVL KP
Uniprot No.

Target Background

Function
Regulates the rotational direction of flagella during chemotaxis.
Database Links

KEGG: tpa:TP_0722

STRING: 243276.TP0722

Protein Families
FliL family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is FliL and how does it relate to other flagellar proteins in Treponema pallidum?

FliL is a flagellar basal body protein that likely plays a crucial role in the motility apparatus of Treponema pallidum, the causative agent of syphilis. While FliL has been less extensively characterized than other flagellar proteins in T. pallidum, it belongs to the broader flagellar machinery that includes well-studied components such as the FlaB family (FlaB1, FlaB2, FlaB3) and other basal body proteins like FlgB, FlgC, FliE, and FliF . In spirochetes, flagellar proteins are particularly important as they contribute to the distinctive corkscrew motility that allows these pathogens to navigate through viscous environments and tissues during infection.

The organization of flagellar genes in spirochetes follows patterns reminiscent of other bacteria, with operonic arrangements and sigma28-like regulatory elements controlling expression . In related treponemes such as T. denticola, flagellar genes like flgB, flgC, fliE, fliF, fliG, fliH, and fliI have been identified in clustered genomic regions, suggesting coordinated expression of these motility components .

How has recent technological progress advanced our understanding of T. pallidum flagellar proteins?

Recent breakthroughs in T. pallidum research have dramatically expanded our ability to study this previously intractable organism. After over a century of failed attempts, T. pallidum can now be continuously cultured in vitro using mammalian cell co-culture systems . This cultivation capability allows researchers to produce sufficient quantities of spirochetes for protein studies without relying solely on rabbit infection models.

Additionally, the development of genetically modified T. pallidum strains, such as those expressing green fluorescent protein (GFP), has opened new avenues for investigating spirochete-host interactions and protein localization . These fluorescent strains enable visualization of T. pallidum interactions with host cells both in vitro and in infected tissues, providing unprecedented opportunities to study the functional roles of flagellar proteins like FliL in real-time .

What expression systems are most effective for recombinant T. pallidum flagellar proteins?

For recombinant expression of T. pallidum proteins, Escherichia coli-based systems have proven most effective. Successful expression requires careful optimization of several parameters:

Vector selection: Insertion of PCR-amplified DNA into E. coli expression vectors has yielded high-level expression of various T. pallidum antigens . Expression vectors that incorporate N-terminal hexahistidine tags facilitate subsequent purification steps.

Expression conditions: Temperature, induction timing, and media composition must be optimized for each specific protein. For T. pallidum membrane proteins, lower induction temperatures (16-25°C) often improve proper folding and solubility.

Codon optimization: Due to differences in codon usage between T. pallidum and E. coli, codon optimization of the target gene may improve expression levels, particularly for proteins like FliL that may contain rare codons.

The expression strategy that has been successful for other T. pallidum proteins involves PCR amplification of the target gene, insertion into an appropriate expression vector, and transformation into a suitable E. coli strain . This approach has yielded high-level expression of immunogenic lipoproteins such as TpN17, TpN47, and TmpA that share certain structural characteristics with flagellar proteins .

What purification strategies yield high-purity recombinant flagellar proteins?

Based on successful approaches with other T. pallidum proteins, the following purification strategy would be recommended for FliL:

  • Affinity chromatography: Metal chelate affinity chromatography using N-terminal hexahistidine-tagged proteins has proven highly effective for T. pallidum protein purification . Nickel or cobalt resins allow for efficient single-step enrichment.

  • Buffer optimization: Buffers containing mild detergents (0.1% Triton X-100 or 0.05% DDM) may improve solubility while maintaining native conformation, particularly important for membrane-associated proteins like FliL.

  • Size exclusion chromatography: As a polishing step, size exclusion chromatography can separate properly folded monomeric protein from aggregates or degradation products.

  • Endotoxin removal: For immunological studies, endotoxin removal using polymyxin B columns or phase separation techniques is essential to prevent lipopolysaccharide contamination from the E. coli expression system.

This multi-step purification approach has yielded highly pure recombinant T. pallidum proteins suitable for diagnostic and research applications, with preserved structural and antigenic properties .

How can recombinant FliL contribute to understanding T. pallidum pathogenesis?

Recombinant FliL can serve as a valuable tool for investigating several aspects of T. pallidum pathogenesis:

Motility mechanisms: Heterologous expression of T. pallidum flagellar components in model organisms has demonstrated functional conservation and interference with motility. Similar approaches with FliL could elucidate its specific role in the unique motility apparatus of spirochetes . Studies with related spirochetes have shown that expressing treponemal flagellar genes in Salmonella typhimurium reduced swarming motility, while in E. coli, such expression conferred a non-motile phenotype and reduced flagellar numbers .

Tissue invasion: T. pallidum shows remarkable ability to disseminate rapidly from the infection site and establish persistent infection throughout the body . By studying the contribution of flagellar proteins like FliL to this process, researchers can better understand the spirochete's invasive capabilities. Animal model studies with other T. pallidum proteins have revealed a cyclic burden pattern in tissues after infection, suggesting complex dissemination dynamics that may involve flagellar function .

Immune evasion: The flagellar apparatus in T. pallidum is largely periplasmic, potentially shielding these proteins from antibody recognition. Understanding FliL's location and accessibility to the immune system could provide insights into the "stealth pathogen" properties of T. pallidum .

What diagnostic potential does recombinant FliL have for syphilis detection?

While FliL has not been specifically evaluated for syphilis diagnosis in the provided search results, several comparable flagellar and membrane proteins have shown significant diagnostic utility:

Sensitivity and specificity: Other flagellar proteins, particularly the FlaB family, have demonstrated excellent diagnostic performance. The middle portions (variable regions) of FlaB proteins showed high sensitivity (91.6-95.0%) and specificity (94.8-100%) in serological assays . This suggests that unique epitopes in the variable regions of flagellar proteins like FliL might similarly serve as specific diagnostic targets.

Comparative performance: In evaluating any new diagnostic antigen, comparison with established tests is essential. The benchmark Architect Syphilis TP has sensitivity of 95.5% and specificity of 94.8% . Any new FliL-based test would need to meet or exceed these parameters to be clinically valuable.

Stage-specific detection: Different T. pallidum antigens show varying sensitivity at different stages of syphilis infection. For instance, TmpA demonstrated sensitivity ranging from 84% to 97%, with highest values for secondary syphilis, while TpN17 achieved 100% sensitivity for primary and secondary stages and 93.2% for recent latent syphilis . Understanding stage-specific antibody responses to FliL would be crucial for its diagnostic application.

The data table below summarizes diagnostic performance of various T. pallidum antigens as potential models for FliL application:

What methodological challenges exist in expressing and studying functional recombinant FliL?

Working with T. pallidum flagellar proteins presents several technical challenges:

Structural integrity: Ensuring that recombinantly expressed FliL maintains its native conformation is challenging. Validation approaches might include circular dichroism spectroscopy to assess secondary structure, and limited proteolysis to evaluate folding quality.

Interaction partners: FliL functions as part of a complex flagellar apparatus, interacting with multiple other proteins. Identifying these interaction partners through pull-down assays, bacterial two-hybrid systems, or co-immunoprecipitation with other flagellar components would be essential for functional characterization.

Heterologous expression effects: When expressed in model organisms, T. pallidum flagellar components can interfere with the host's motility apparatus. This phenomenon, observed with other flagellar proteins, suggests conserved functional domains that interact with the flagellar machinery across bacterial species . This presents both a challenge and an opportunity for studying FliL function.

Membrane association: If FliL is membrane-associated, as is likely based on its role in other bacteria, expression with appropriate membrane-targeting sequences and subsequent extraction with suitable detergents would be crucial for maintaining native structure.

How might FliL contribute to vaccine development strategies against syphilis?

The potential of FliL as a vaccine candidate should be evaluated in the context of what we know about other T. pallidum proteins:

Immunogenicity assessment: Determining if FliL elicits robust antibody responses during natural infection is the first step. This could be evaluated using sera from syphilis patients at different disease stages to detect anti-FliL antibodies.

Localization studies: The accessibility of FliL to antibodies in intact spirochetes would significantly impact its vaccine potential. The newly developed GFP-expressing T. pallidum strains could facilitate studies of protein localization and accessibility .

Immune protection evaluation: Animal models, particularly the New Zealand rabbit model, have been successfully used to evaluate immune protection of vaccine candidates such as Tp0971, which was shown to induce high levels of specific antibodies, delay skin damage, and promote healing at infected sites . Similar methodologies could be applied to assess FliL's protective potential.

Combination approaches: The most effective syphilis vaccine may require multiple antigens. Combining FliL with other immunogenic proteins could enhance protective efficacy, as demonstrated by improved diagnostic sensitivity when multiple antigens were combined in diagnostic assays .

How can new cultivation methods advance FliL research?

The breakthrough in continuous in vitro cultivation of T. pallidum offers unprecedented opportunities for FliL research:

Protocol implementation: Researchers can now follow established protocols for culturing T. pallidum in co-culture with mammalian cells (specifically Sf1Ep cells), where spirochetes undergo 4-5 successive cell divisions over a one-week period . This system allows for production of sufficient quantities of spirochetes for protein studies.

Genetic manipulation: The ability to maintain T. pallidum in culture opens possibilities for genetic manipulation to study FliL function, including potential gene knockout or modification approaches that were previously impossible .

Native protein isolation: In vitro cultivation could potentially allow isolation of native FliL from T. pallidum, providing a reference standard against which recombinant protein can be compared for structural and functional authenticity.

What novel techniques are emerging for studying T. pallidum flagellar protein interactions in real-time?

Recent technological advances offer exciting possibilities for studying FliL and other flagellar proteins:

Fluorescent spirochete strains: The development of GFP-expressing T. pallidum strains enables visualization of spirochete interactions with host cells both in vitro and within infected tissues . This technology could be combined with fluorescently tagged antibodies against FliL to study its location and role during infection.

Flow cytometric assays: Flow cytometry-based assays have been developed to assess antibody-mediated damage to T. pallidum's outer membrane . Similar approaches could be applied to study how antibodies targeting FliL affect spirochete viability and membrane integrity.

Opsonophagocytosis visualization: Using GFP-expressing spirochetes, researchers can directly observe opsonophagocytosis by macrophages , providing a powerful tool to assess the functional significance of anti-FliL antibodies in immune clearance.

These emerging techniques represent the cutting edge of T. pallidum research methodology and offer promising approaches to unraveling the complex biology of this challenging pathogen's flagellar system, potentially leading to new diagnostic and therapeutic strategies for syphilis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.