Recombinant Treponema pallidum Probable biotin transporter BioY (bioY)

Shipped with Ice Packs
In Stock

Description

Functional Role in Treponema pallidum

BioY facilitates biotin import, a vitamin essential for fatty acid synthesis and energy metabolism. Key findings include:

  • Essentiality: T. pallidum lacks biotin biosynthesis pathways, making BioY indispensable for survival .

  • Structural Homology: BioY shares homology with biotin transporters in other bacteria, such as E. coli’s BioY, which binds biotin and its precursors with high affinity .

  • Operon Context: In T. pallidum, bioY is not part of the TRAP-T (Tripartite ATP-independent periplasmic transporter) system but functions independently .

Research Applications

Recombinant BioY is primarily used for:

  1. Mechanistic Studies: Investigating biotin transport kinetics and inhibition strategies .

  2. Antigen Characterization: Although not yet utilized in commercial diagnostics, BioY is explored for its immunogenic potential in syphilis research .

  3. Structural Biology: Efforts to resolve its 3D structure could aid in drug design targeting biotin uptake .

Comparative Analysis with Other Transporters

TransporterSubstrateRole in T. pallidumRecombinant Use
BioYBiotinNutrient acquisitionMechanistic/drug studies
ThiXYZ (ABC)Thiamin precursorsVitamin B1 uptakeNot characterized in T. pallidum
YkoEDC (ECF)HMP/thiaminThiamin scavengingLimited data

Challenges and Future Directions

  • Structural Data: No resolved structure exists for BioY, limiting mechanistic insights .

  • Diagnostic Potential: Unlike immunodominant antigens (e.g., TpN17, TmpA), BioY has not been integrated into syphilis serology due to lower antibody reactivity in patients .

  • Therapeutic Targeting: Inhibiting BioY could disrupt biotin homeostasis, offering a novel antimicrobial strategy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
bioY; TP_0228; Probable biotin transporter BioY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
bioY
Target Protein Sequence
MHRTEPTINCVHDGTRSLHLSIDTTRALPAHSGNEPTRTHLAAVRVSLLKTIPVAPPKIL KDSSFRVTLRIDPSEEYCTMHRSKSLAFVALFAALISSSALVSIPLKPVPLVLQNAAAVL TGLLLGPRDGALAVLSFLGAGLLGLPVFSGGRGGYTALFAPTGGFLLGYILAATLAGAIA QHHRLSCTPPRGGGRALLLWIRLTVATLVGFLSIYSIGLPVLGYVLGLRTGELMLGVFLP FFLADTLKIALVVLLAHHLAPTVRRHLYRHG
Uniprot No.

Target Background

Function
Probable biotin transporter.
Database Links

KEGG: tpa:TP_0228

STRING: 243276.TP0228

Protein Families
BioY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the bioY protein in Treponema pallidum and what is its functional significance?

BioY in Treponema pallidum functions as a probable biotin transporter, playing a critical role in the uptake of biotin, an essential vitamin cofactor. As part of the cell envelope system, bioY facilitates the acquisition of biotin from the host environment, which is crucial for T. pallidum survival given its reduced metabolic capabilities . The protein consists of 271 amino acids and is encoded within the highly reduced genome of T. pallidum, which reflects its essential nature for this obligate human pathogen . Understanding bioY's function is particularly important because T. pallidum lacks many biosynthetic pathways and relies heavily on nutrient acquisition from its host.

How does bioY expression change during different stages of T. pallidum infection?

Transcriptional profiling studies have shown that bioY expression patterns differ between in vivo rabbit infection models and in vitro culture conditions. While bioY-specific expression wasn't highlighted in the comparative analyses, similar transport proteins showed varying expression levels between these environments. T. pallidum generally exhibits higher expression of solute transport-related genes during rabbit infection compared to in vitro culture, suggesting bioY may follow similar patterns as the organism adapts to different nutrient availabilities . This differential expression likely reflects the adaptation of T. pallidum to host environments where biotin availability may be limited, requiring upregulation of transport mechanisms.

What methods are commonly used to produce recombinant T. pallidum bioY protein for research?

Recombinant T. pallidum bioY protein can be expressed in several heterologous systems, with E. coli being the most commonly employed. Other expression systems include yeast, baculovirus, and mammalian cell systems, each offering different advantages depending on research objectives . The methodological approach typically involves:

  • Cloning the bioY gene (tp0298) from T. pallidum genomic DNA

  • Insertion into an appropriate expression vector containing affinity tags (His-tag, GST, etc.)

  • Expression in the chosen host system under optimized conditions

  • Purification using affinity chromatography

  • Verification of protein integrity using SDS-PAGE and Western blotting

For membrane proteins like bioY, expression conditions must be carefully optimized to ensure proper folding and functionality of the recombinant protein.

What experimental challenges exist when studying bioY function in vitro?

Studying bioY function presents several significant challenges:

  • Membrane protein nature: As a transporter, bioY is an integral membrane protein, making it difficult to express, purify, and maintain in a properly folded, functional state.

  • T. pallidum cultivation limitations: Despite recent advances in continuous in vitro cultivation of T. pallidum, the microaerobic conditions (1.5% O₂, 5% CO₂) and specialized media requirements make native protein studies challenging .

  • Functional assay development: Designing assays to measure biotin transport activity requires specialized liposome reconstitution or membrane vesicle systems.

  • Protein stability: Maintaining stability of the purified recombinant protein often requires careful optimization of detergent or lipid environments.

These challenges necessitate creative experimental approaches, such as using reporter systems or developing specialized reconstitution methods to study bioY's transport activity.

What is known about bioY's role in T. pallidum pathogenesis and survival during infection?

The role of bioY in T. pallidum pathogenesis relates to its function in nutrient acquisition:

  • Metabolic dependence: T. pallidum has a reduced genome with limited biosynthetic capabilities, making biotin acquisition from the host essential for survival .

  • Persistent infection: The ability to effectively scavenge biotin likely contributes to T. pallidum's capacity to establish long-term infection.

  • Transcriptional adaptation: RNA-seq analysis shows that T. pallidum modulates expression of transport proteins during infection, with genes related to nutrient acquisition showing increased expression in vivo compared to in vitro .

While direct evidence specifically linking bioY to virulence is limited, its probable function in nutrient acquisition places it among the essential systems required for T. pallidum's parasitic lifestyle and persistent infection capabilities.

What expression systems provide optimal yields of functional recombinant bioY?

The optimal expression system for bioY depends on research objectives, with several options available:

Expression SystemAdvantagesDisadvantagesBest Applications
E. coliHigh yield, cost-effective, rapid expressionMay form inclusion bodies, lacks eukaryotic post-translational modificationsInitial protein characterization, antibody production
Yeast (S. cerevisiae, P. pastoris)Eukaryotic folding machinery, glycosylation capacityLower yields than E. coli, longer expression timeFunctional studies requiring proper folding
BaculovirusHigh expression of membrane proteins, proper foldingTechnical complexity, costly, time-consumingStructural studies, functional assays
Mammalian cellsNative-like membrane environment, complete post-translational modificationsLowest yields, highest cost, complex protocolsInteraction studies, functional characterization

For membrane proteins like bioY, E. coli systems using specialized strains (C41, C43) with modifications to prevent toxicity of membrane protein overexpression often provide a good balance of yield and functionality . Codon optimization for the expression host and fusion with solubility-enhancing tags can further improve expression outcomes.

How can the bioactivity of recombinant bioY be assessed in research settings?

Assessing bioY's biotin transport activity requires specialized approaches:

  • Liposome reconstitution assays:

    • Purified bioY is incorporated into artificial liposomes

    • Transport is measured using radiolabeled or fluorescently tagged biotin

    • Internal vs. external biotin concentrations are quantified over time

  • Whole-cell transport assays:

    • Expression host cells lacking endogenous biotin transporters

    • Measurement of biotin uptake using labeled biotin

    • Comparison of uptake rates between bioY-expressing and control cells

  • Binding assays:

    • Surface plasmon resonance (SPR) to measure biotin binding affinity

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Fluorescence-based binding assays using biotin analogs

  • Growth complementation:

    • Functional complementation of biotin transport-deficient bacterial strains

    • Assessment of growth restoration in biotin-limited media

These methodologies can be adapted depending on the specific research questions and available resources.

What techniques are most effective for studying bioY's membrane topology and structure?

Several complementary techniques can reveal bioY's membrane topology and structure:

  • Computational prediction:

    • Hydropathy analysis and transmembrane domain prediction algorithms

    • Homology modeling based on related transporters with solved structures

  • Biochemical mapping:

    • Cysteine scanning mutagenesis with membrane-impermeable sulfhydryl reagents

    • Protease accessibility mapping to identify exposed regions

  • Structural determination approaches:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly powerful for membrane proteins)

    • NMR studies on isolated domains or the whole protein in detergent micelles

  • Accessibility studies:

    • Epitope insertion and antibody binding to map exposed regions

    • Fluorescence quenching assays to determine membrane-embedded regions

Combining these approaches provides a comprehensive understanding of bioY structure that can inform functional studies and potential therapeutic targeting.

How can recombinant bioY be utilized in syphilis diagnostic development?

While current syphilis diagnostics primarily utilize other T. pallidum recombinant antigens, bioY has potential diagnostic applications:

  • Serological test development:

    • bioY could be evaluated as part of an expanded antigen panel for detecting antibodies during different stages of syphilis infection

    • Potential for use in multi-antigen assays that improve sensitivity and specificity

  • Staged diagnosis approaches:

    • Research suggests differential immune responses to T. pallidum antigens during disease progression

    • bioY could be assessed for its ability to distinguish between disease stages or treatment outcomes

  • Technical considerations:

    • Expression as a soluble recombinant protein (without transmembrane domains)

    • Fusion with carrier proteins to enhance solubility and immunoreactivity

    • Incorporation into existing ELISA, Western blot, or point-of-care testing platforms

Research would need to systematically evaluate bioY's immunogenicity across patient populations with different stages of syphilis to determine its diagnostic utility compared to established antigens like Tp47, Tp17, and TmpA .

What role might bioY play in antimicrobial development strategies against T. pallidum?

As an essential nutrient transporter, bioY represents a potential antimicrobial target:

  • Target validation approaches:

    • Demonstration of bioY essentiality through attempted gene disruption

    • RNA interference or antisense strategies to reduce expression

    • Correlation of biotin availability with T. pallidum survival

  • Inhibitor development strategies:

    • Structure-based design of competitive inhibitors that bind the biotin-binding site

    • Screening for molecules that disrupt bioY oligomerization or membrane insertion

    • Development of biotin analogs that block transport but cannot be utilized metabolically

  • Challenges in therapeutic development:

    • Specificity versus human biotin transporters

    • Membrane permeability of inhibitor compounds

    • Delivery to T. pallidum in various tissue niches

The recent advancement in continuous in vitro culture systems for T. pallidum now enables more sophisticated approaches to antimicrobial screening that weren't previously possible .

How might the recent advances in T. pallidum in vitro cultivation impact bioY research?

The breakthrough in continuous in vitro cultivation of T. pallidum opens significant new research possibilities for bioY studies:

  • Native expression analysis:

    • Direct comparison of bioY expression levels under different growth conditions

    • Ability to manipulate nutrient availability and measure impacts on bioY expression

    • Time-course studies during different growth phases

  • Genetic manipulation opportunities:

    • Potential for gene knock-down approaches in cultured organisms

    • Complementation studies with modified bioY variants

    • Reporter gene fusions to study regulation

  • Functional studies:

    • Transport assays using native versus recombinant bioY

    • Competition studies with inhibitors or biotin analogs

    • Correlation of biotin transport with growth characteristics

The in vitro culture system using modified culture medium (TpCM-2 with CMRL 1066) and microaerobic conditions provides a platform for experiments that were previously impossible with rabbit infection models alone .

What comparative genomic insights might inform future bioY research?

Comparative genomics approaches offer valuable perspectives for bioY research:

  • Evolutionary conservation:

    • Analysis of bioY sequence conservation across Treponema species and strains

    • Identification of highly conserved residues likely essential for function

    • Comparison with biotin transporters in other bacterial pathogens

  • Structural predictions:

    • Using multiple sequence alignments to predict functional domains

    • Identifying species-specific features that might be exploited for selective targeting

    • Modeling potential interaction sites with other components of biotin metabolism

  • Host-pathogen adaptations:

    • Comparison of biotin acquisition strategies across different host-adapted pathogens

    • Investigation of potential co-evolution with host biotin availability

    • Analysis of tissue-specific adaptations in biotin acquisition systems

These comparative approaches can guide experimental design and help prioritize residues for site-directed mutagenesis studies to understand bioY function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.