Recombinant Treponema pallidum Protein HflC (hflC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hflC; TP_0114; Protein HflC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
hflC
Target Protein Sequence
MRKRGLQVHARVRPVLNIGIVVGVLLGGVVLLQPFYLIQEGQVALITQFGEIIKTNNTAG LYVRAPFLHHVHKYTAKLLRVDGDPQKIPTKEKQFIEVDTTSRWRIEDVKKFYQSLGTYE AAYSRISDIIDSSVRDIITVNGLDDVVRSTNAINESNHSEQFDVPVSQLAFDRGAEKTAH MTIEKGRESLAREISQAANDQLKDFGIVVVDVIFKGIKYSDELQASVFNRMVKERNQIAQ MFRSTGEGKKAEWLGKLDNEKRSLLSKAYEEAERIKGEADARAAAVYAQSYGKSPEFYGF WKSLEVYKKSLPDTEKILSTDLEYFKHLYQH
Uniprot No.

Target Background

Function
HflC and HflK proteins are involved in the regulation of a protease.
Database Links

KEGG: tpa:TP_0114

STRING: 243276.TP0114

Protein Families
Band 7/mec-2 family, HflC subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant HflC?

The most validated expression system for recombinant HflC production is E. coli with an N-terminal His tag fusion. This approach has been successfully implemented with purities exceeding 95% as determined by SDS-PAGE analysis . Alternative expression systems that could be considered include:

Expression SystemAdvantagesPotential Challenges
E. coliHigh yield, economical, well-established protocolsPotential improper folding of membrane proteins
YeastBetter folding of complex proteins, eukaryotic post-translational modificationsLower yield than E. coli, longer cultivation time
BaculovirusExcellent for complex eukaryotic proteins, high expression levelsMore technically demanding, higher cost
Mammalian cellsNative-like folding and modificationsLowest yield, highest cost, time-consuming

Similar to the successful expression of TpF1 (Tp1038) described in literature, optimizing induction conditions (IPTG concentration, temperature, duration) is critical for maximizing soluble protein yield .

What purification strategies yield the highest purity and activity for recombinant HflC?

A multi-step purification strategy is recommended:

  • Initial Capture: Ni-NTA affinity chromatography utilizing the His-tag (binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole)

  • Elution: Gradient or step elution with increasing imidazole concentration (50-250 mM)

  • Secondary Purification: Size exclusion chromatography to remove aggregates and contaminants

  • Quality Control: Purity assessment by SDS-PAGE (target >95%) and Western blot with anti-His antibodies

When working with membrane-associated proteins like HflC, including 0.1% non-ionic detergent (e.g., n-dodecyl-β-D-maltoside) in all buffers can improve solubility and prevent aggregation. Final protein should be stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 for optimal stability .

How can researchers investigate potential interactions between HflC and host cells?

Several methodological approaches can be employed:

  • Cell Adhesion Assays: Similar to studies with Tp0136 , researchers can evaluate if HflC mediates bacterial attachment to host cells by:

    • Pre-incubating human cell lines (e.g., HUVECs) with recombinant HflC

    • Measuring adhesion of fluorescently labeled T. pallidum

    • Comparing adhesion rates with and without HflC pre-treatment

  • Immunological Response Assessment: Following the model used for Tp0965 :

    • Treat endothelial cells with recombinant HflC at various concentrations (200-800 ng/ml)

    • Measure expression changes in adhesion molecules (ICAM-1, E-selectin) using RT-PCR and cell ELISA

    • Quantify inflammatory cytokine production (IL-8, MCP-1)

    • Evaluate changes in endothelial permeability using transwell systems

  • Competitive Inhibition Experiments: Using methods similar to those employed for Tp0136 :

    • Coat chamber slides with cellular and plasma fibronectin

    • Pre-incubate with recombinant HflC (200-800 pmol)

    • Add T. pallidum spirochetes and quantify binding by darkfield microscopy

What methodologies can determine the immunological significance of HflC in T. pallidum infection?

A comprehensive immunological investigation would include:

  • Serological Profiling:

    • Develop an ELISA using purified recombinant HflC

    • Test sera from patients at different stages of syphilis (primary, secondary, latent, tertiary)

    • Compare reactivity with sera from patients with related spirochetal diseases (Lyme disease, leptospirosis) to assess specificity

    • Analyze correlation between antibody titers and disease progression

  • T-Cell Response Characterization:

    • Isolate peripheral blood mononuclear cells from syphilis patients

    • Stimulate with recombinant HflC and measure proliferation responses

    • Characterize cytokine profiles (IFN-γ, IL-4, IL-17) to determine T-helper cell polarization

  • Neutrophil Interaction Studies: Based on findings related to Tp92 , evaluate if HflC affects neutrophil function:

    • Analyze apoptosis rates of neutrophils exposed to recombinant HflC using AO/EB staining

    • Quantify changes in reactive oxygen species production

    • Measure neutrophil extracellular trap formation

How can researchers verify that recombinant HflC maintains native conformation and biological activity?

Validating proper folding and activity involves multiple complementary approaches:

  • Structural Analysis:

    • Circular dichroism spectroscopy to assess secondary structure elements

    • Limited proteolysis profiles compared to native protein extracted from T. pallidum

    • Thermal shift assays to evaluate protein stability

  • Functional Validation:

    • Develop binding assays for putative interaction partners

    • Compare activity of recombinant protein with that of native HflC in cell-based assays

    • Use anti-HflC antibodies to verify similar epitope presentation between recombinant and native forms

  • Comparative Studies:

    • Express HflC with different tags or in different systems and compare functional properties

    • Use multiple recombinant fragments to identify key functional domains

How can genetic manipulation techniques be applied to study HflC function in living T. pallidum?

Recent advances in T. pallidum genetic manipulation provide powerful new approaches:

  • Fluorescent Tagging Strategies: Building on approaches described by Romeis et al. :

    • Generate constructs with Extra-superfolder GFP fused to HflC

    • Transform cultivated T. pallidum using suicide vectors

    • Visualize protein localization using fluorescence microscopy

    • Monitor protein dynamics during host cell interactions

  • Gene Modification Approaches:

    • Create HflC knockout strains using homologous recombination

    • Develop inducible expression systems for HflC variants

    • Perform site-directed mutagenesis to identify critical functional residues

  • Complementation Studies:

    • Express wild-type or mutant HflC in knockout strains

    • Assess restoration of function to confirm phenotype specificity

    • Compare virulence and host interaction phenotypes

The table below outlines protocols for genetic manipulation of T. pallidum based on recent methodological advances:

StepProtocol DetailsCritical Considerations
Construct preparationSuicide vector containing HflC with GFP and kanR markersEnsure codon optimization for T. pallidum
TransformationCo-culture with Sf1Ep cells for 1 week, then transfer 5×10^7 organismsMaintain microaerophilic conditions
SelectionAdd kanamycin (200 μg/ml) after recovery periodMonitor biweekly by darkfield microscopy
VerificationPCR amplification of genomic DNA from transformantsConfirm proper integration at target locus
Functional analysisCompare growth and infectivity of modified strainUse rabbit model for in vivo assessment

What are the most effective strategies for studying HflC's potential role in T. pallidum pathogenesis?

Based on research approaches used for other T. pallidum proteins:

  • Animal Model Studies:

    • Rabbit infection model injected with recombinant HflC or anti-HflC antibodies

    • Temporal monitoring of bacterial dissemination patterns

    • Histopathological analysis of tissue samples to assess vascular changes

    • Quantitative PCR to measure bacterial load in different tissues

  • Ex Vivo Tissue Models:

    • Human skin explant models to evaluate T. pallidum penetration

    • Co-culture with vascular endothelial cells to assess barrier function changes

    • Three-dimensional tissue constructs to model complex host-pathogen interactions

  • Transcriptomic Analysis:

    • RNA-seq of T. pallidum during different stages of infection

    • Correlation of HflC expression patterns with disease progression

    • Identification of co-regulated genes to infer functional relationships

How can researchers assess whether HflC contributes to immune evasion mechanisms of T. pallidum?

Several research designs can address this question:

  • Complement Interaction Studies:

    • Analyze binding of complement components to recombinant HflC

    • Measure complement activation in the presence/absence of HflC

    • Assess survival of T. pallidum exposed to complement with/without HflC supplementation

  • Macrophage Response Modulation:

    • Evaluate phagocytosis rates of T. pallidum opsonized with anti-HflC antibodies

    • Measure changes in macrophage activation markers following HflC exposure

    • Analyze alterations in phagolysosome formation and bacterial killing

  • Vascular Permeability Investigation: Building on findings for Tp0136 :

    • Utilize three-dimensional microfluidic angiogenesis systems

    • Assess whether HflC affects endothelial tight junctions

    • Investigate activation of signaling pathways (e.g., PI3K-AKT) that regulate vascular permeability

    • Determine if HflC promotes T. pallidum dissemination through vascular barrier disruption

What are the most common challenges when working with recombinant HflC and how can they be addressed?

Researchers frequently encounter several obstacles:

  • Solubility Issues:

    • Problem: Being a membrane protein, HflC may form insoluble aggregates

    • Solution: Express as fusion protein with solubility tags (MBP, SUMO), use mild detergents (0.1% DDM or CHAPS), optimize buffer conditions (add glycerol, adjust salt concentration)

  • Low Expression Yield:

    • Problem: Membrane proteins often express poorly in heterologous systems

    • Solution: Try autoinduction media, lower induction temperature (16-20°C), optimize codon usage for expression host, express truncated domains lacking transmembrane regions

  • Protein Degradation:

    • Problem: Rapid degradation during expression or purification

    • Solution: Add protease inhibitors, perform purification at 4°C, minimize time between steps, add stabilizing agents (trehalose, glycerol)

How can researchers optimize immunological assays using recombinant HflC?

To develop robust immunological assays:

  • ELISA Optimization:

    • Perform checkerboard titration to determine optimal coating concentration (typically 1-10 μg/ml)

    • Test multiple blocking agents (BSA, casein, commercial blockers) to minimize background

    • Optimize antibody dilutions and incubation times/temperatures

    • Include appropriate controls (other T. pallidum proteins, proteins from related spirochetes)

  • Antibody Production Strategies:

    • Use multiple animal species for broader epitope recognition

    • Implement prime-boost immunization protocols

    • Consider peptide immunization targeting predicted surface-exposed regions

    • Verify antibody specificity against native T. pallidum proteins

  • Cross-Reactivity Assessment:

    • Test against proteins from related spirochetes (Borrelia, Leptospira)

    • Perform epitope mapping to identify unique versus conserved regions

    • Pre-adsorb sera with heterologous antigens to improve specificity

What experimental designs best address data variability in functional studies with recombinant HflC?

To enhance reproducibility and reliability:

  • Standardization Protocols:

    • Establish consistent protein preparation methods with quality control checkpoints

    • Include internal standards across experimental batches

    • Implement rigorous protein quantification (BCA assay, amino acid analysis)

  • Statistical Design Considerations:

    • Perform power analysis to determine appropriate sample sizes

    • Use multiple biological and technical replicates (minimum n=3)

    • Include dose-response relationships rather than single concentrations

    • Implement time-course studies to capture temporal dynamics

  • Controls and Validation:

    • Include both positive controls (well-characterized T. pallidum proteins) and negative controls (irrelevant proteins with similar physicochemical properties)

    • Verify findings using multiple methodological approaches

    • Consider blinded analysis for subjective measurements

How might newly developed fluorescent tagging techniques enhance HflC research?

Recent breakthroughs in fluorescent T. pallidum strains offer transformative opportunities:

  • Live Cell Imaging Applications:

    • Create HflC-fluorescent protein fusions using the methodologies developed for GFP-expressing T. pallidum

    • Visualize protein dynamics during host cell interactions

    • Track HflC localization changes during different growth phases

    • Implement super-resolution microscopy for detailed subcellular localization

  • Flow Cytometry-Based Assays:

    • Develop antibody binding assays to assess surface exposure

    • Measure membrane integrity following immune challenge

    • Sort bacterial subpopulations based on HflC expression levels

  • Dual-Labeling Strategies:

    • Combine bacterial GFP expression with fluorescently-labeled host proteins

    • Visualize co-localization with host cellular components

    • Monitor recruitment of host factors to bacterial attachment sites

How can transcriptomic and proteomic approaches be integrated to clarify HflC function?

Multi-omics integration offers powerful insights:

  • Correlation Analysis:

    • Compare HflC expression patterns with other T. pallidum genes during infection stages

    • Identify co-regulated genes that may function in similar pathways

    • Analyze protein-protein interaction networks to predict functional associations

  • Differential Expression Studies:

    • Compare transcriptomes of wild-type and HflC-mutant strains

    • Identify compensatory responses that may reveal functional redundancies

    • Assess host cell transcriptional responses to purified HflC

  • Integrative Analysis Frameworks:

    • Implement computational modeling to integrate transcriptomic, proteomic, and functional data

    • Develop testable hypotheses about HflC function based on systems biology approaches

    • Utilize gene ontology and pathway enrichment analyses to categorize HflC-dependent processes

What potential roles might HflC play in vaccine development against syphilis?

Building on research with other T. pallidum membrane proteins:

  • Antigen Design Considerations:

    • Identify surface-exposed epitopes using computational prediction and experimental validation

    • Create recombinant constructs focusing on immunogenic regions

    • Develop multi-epitope vaccines incorporating HflC with other established antigens (e.g., Tp0136, TpF1)

  • Immune Response Characterization:

    • Evaluate both humoral and cell-mediated responses to HflC immunization

    • Assess neutralizing capacity of anti-HflC antibodies

    • Determine if HflC immunization affects T. pallidum dissemination patterns in animal models

  • Delivery Platform Assessment:

    • Compare effectiveness of protein subunit, DNA vaccine, and viral vector approaches

    • Evaluate various adjuvant combinations to enhance immunogenicity

    • Develop strategies to overcome T. pallidum's immune evasion mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.