Recombinant Treponema pallidum Protein HflK (hflK)

Shipped with Ice Packs
In Stock

Description

Introduction

Treponema pallidum is a spirochetal bacterium that causes syphilis, a sexually transmitted infection with potentially severe systemic consequences if left untreated . Understanding the molecular mechanisms underlying the pathogenesis of T. pallidum is crucial for developing effective diagnostic and therapeutic strategies . Recombinant Treponema pallidum proteins, such as HflK (also known as Tp0624), are valuable tools for studying the bacterium's interactions with host cells and the host immune response .

General Information

HflK, a protein derived from the genome of T. pallidum, exhibits strong immunogenicity and immunoreactivity, making it a target for research into syphilis pathogenesis . Studies indicate that HflK, along with other T. pallidum proteins, plays a significant role in the bacterium's interaction with host cells, such as endothelial cells and macrophages, and in the modulation of the host's immune response .

Impact on Endothelial Cells

Recombinant Treponema pallidum proteins can impact endothelial cells, which form the inner lining of blood vessels . Research has demonstrated that treatment of human umbilical vein endothelial cells (HUVECs) with recombinant T. pallidum proteins can lead to increased expression of adhesion molecules like ICAM-1 and E-selectin, as well as the chemokine MCP-1 . These molecules facilitate the adhesion and migration of monocytes to the endothelial cells, contributing to inflammation . Furthermore, these proteins can induce reorganization of the F-actin cytoskeleton and decrease the expression of claudin-1, a protein important for maintaining the integrity of endothelial cell barriers . This can result in increased endothelial permeability, which is associated with the transendothelial migration of monocytes .

Role in Vascular Inflammation

Vascular inflammation is a critical component of syphilis pathogenesis, leading to tissue damage . Treponema pallidum proteins can promote the migration and adherence of immune cells, such as THP-1 monocytes, to human dermal vascular smooth muscle cells (HDVSMCs) . This process is mediated by increased expression of MCP-1 and ICAM-1 . The activation of signaling pathways like PI3K/Akt, p38 MAPK, and NF-κB in HDVSMCs also contributes to the inflammatory response .

Impact on Macrophages

Macrophages, key players in the immune system, are also affected by Treponema pallidum proteins . Stimulation of macrophages with recombinant T. pallidum proteins can induce the expression and secretion of pro-inflammatory cytokines such as IL-1β, IL-6, and IL-8 . This process involves the activation of ER stress and the ROS/NF-κB pathway in macrophages . These findings suggest that T. pallidum proteins contribute to the inflammatory response observed during syphilis infection by modulating macrophage function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
hflK; TP_0113; Protein HflK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-328
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
hflK
Target Protein Sequence
MRIPKWTPATWSVVAGCIGGVLGIVIVGIASPIRIISPTDNGVVTRFGKYHRTLEPGLHY LIPFVEWVYKVPVTKVQKEEFGFRTSKSSEQSHYVNNISHESLMLTGDLNIVDVEWVVQY RIVDPRAWVFNVESQERRQTIRDISKAVVNSLIGDRAILDIMGPERSAIQMRAKDMMNVL LKRIGLGVLVSSVQLQNVVPPQEVQQAFEDVNIAIQDMNRLINEGKESYNREIPKARGDA DKLIQEAMGYANERVNRAKGDVARFDSIYAEYVKAPHVTKTRLYLEGLGAILEKTENVLL IDKKLENLLTLKDISKVSKKVVAGTREE
Uniprot No.

Target Background

Function

HflC and HflK may encode or regulate a protease.

Database Links

KEGG: tpa:TP_0113

STRING: 243276.TP0113

Protein Families
Band 7/mec-2 family, HflK subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the function of HflK protein in Treponema pallidum?

HflK (High frequency of lysogenization protein K) in Treponema pallidum is believed to function as a membrane-bound protein involved in protein quality control and regulation of proteolysis, similar to its homologs in other bacteria. In bacterial pathogens, these proteins often play critical roles in survival under stress conditions and can contribute to virulence. Research with other Treponema pallidum proteins, such as Tp0965, has demonstrated that recombinant proteins from this organism can significantly affect host cell interactions, suggesting HflK may have similar important biological functions .

How does HflK differ structurally from other T. pallidum membrane proteins?

While specific structural data comparing HflK to other T. pallidum membrane proteins is limited, membrane proteins in T. pallidum generally contain hydrophobic domains that anchor them to the bacterial membrane. For comparative purposes, other T. pallidum proteins like Tp0965 contain specific domains that interact with host cells, as seen in its ability to affect endothelial cell function. When designing experiments with recombinant HflK, researchers should consider potential transmembrane domains and their preservation in the recombinant form .

What is known about the immunogenicity of HflK in syphilis infection?

Recombinant T. pallidum proteins often display strong immunogenicity and immunoreactivity, as demonstrated with the Tp0965 protein. Similar properties might be expected for recombinant HflK, though specific immunological studies focusing on HflK would be needed to confirm this. Research with Tp0965 has shown that recombinant proteins can activate endothelial cells and affect immune cell recruitment, suggesting HflK may also play a role in the immunopathogenesis of syphilis .

What expression systems are most effective for recombinant HflK production?

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, cost-effectiveInclusion body formationFusion tags, reduced temperature
Yeast systemsBetter folding of eukaryotic proteinsLower yieldCodon optimization
BaculovirusGood for complex proteinsMore complex setupSignal sequence modification
Cell-free systemsAvoids toxicity issuesExpensiveAddition of detergents/lipids

When expressing membrane proteins like HflK, researchers often need to modify the construct to remove transmembrane domains or use solubilization agents to maintain protein solubility.

What purification strategies yield the highest purity and activity for recombinant HflK?

Purification of membrane proteins typically requires special considerations:

  • Initial solubilization using appropriate detergents (e.g., n-Dodecyl β-D-maltoside or CHAPS)

  • Affinity chromatography using tags (His, GST, or MBP tags)

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for further purification

Maintaining the native conformation during purification is crucial for functional studies. For HflK specifically, researchers may need to establish whether the protein requires association with lipids or detergent micelles to maintain its structure. Similar approaches have been used with other T. pallidum recombinant proteins to ensure they retain their biological activities after purification .

How can researchers confirm the proper folding and activity of recombinant HflK?

Multiple complementary approaches are recommended:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Tryptophan fluorescence to detect tertiary structure changes

  • Size exclusion chromatography to detect aggregation

  • Functional assays based on predicted activities (e.g., proteolytic activity modulation)

  • Binding assays to known interaction partners

In studies with Tp0965, researchers verified biological activity by measuring the protein's ability to activate endothelial cells, showing increased expression of adhesion molecules and permeability changes. Similar functional verification approaches would be necessary for recombinant HflK .

What cell models are most appropriate for studying HflK's effects on host cells?

Based on research with other T. pallidum proteins like Tp0965, several cell models may be appropriate:

Cell TypeAdvantagesKey ApplicationsReadouts
Human endothelial cells (HUVECs)Relevant to vascular disseminationBarrier function studiesPermeability, adhesion molecule expression
Immune cells (THP-1, primary monocytes)Relevant to immune responseImmunomodulation studiesCytokine production, chemotaxis
FibroblastsRelevant to tissue infiltrationTissue damage modelsECM production, cytokine release
Neuronal cellsRelevant to neurosyphilisNeurotoxicity studiesNeuronal damage markers

When studying recombinant HflK interactions with host cells, researchers should consider concentration-dependent and time-dependent effects, as observed with Tp0965, which affects endothelial cell function in a dose and time-dependent manner .

How can researchers measure HflK's effect on endothelial barrier function?

Based on methodologies used with Tp0965, several approaches are recommended:

  • Transendothelial electrical resistance (TEER) measurements to assess barrier integrity

  • Permeability assays using fluorescent dextrans of different molecular weights

  • Immunofluorescence analysis of tight junction proteins (claudin-1, ZO-1, occludin)

  • F-actin staining to assess cytoskeletal reorganization (a key indicator of barrier disruption)

  • Transwell migration assays to quantify immune cell transmigration across endothelial monolayers

Research with Tp0965 demonstrated significant effects on endothelial barrier function, including decreased claudin-1 expression and F-actin reorganization, which contributed to increased endothelial permeability and monocyte transmigration .

What signaling pathways should be investigated when studying HflK's cellular effects?

Based on findings with Tp0965, key signaling pathways to investigate include:

  • RhoA/ROCK pathway - critical for cytoskeletal rearrangement and tight junction regulation

  • Inflammatory signaling cascades (NF-κB, MAPK pathways)

  • Adhesion molecule regulation pathways

  • Chemokine production pathways

Research with Tp0965 demonstrated involvement of the RhoA/ROCK pathway in mediating increased endothelial permeability, with ROCK inhibitor Y-27632 protecting against Tp0965-induced barrier dysfunction and monocyte transmigration. Similar pathway analysis would be valuable for understanding HflK's potential effects on host cells .

How does recombinant HflK interact with host innate immune responses?

This represents an advanced research question that requires comprehensive experimental design:

  • Determine whether HflK activates pattern recognition receptors (TLRs, NLRs)

  • Assess cytokine/chemokine production profiles in immune cells exposed to HflK

  • Evaluate inflammasome activation and processing of IL-1β

  • Measure neutrophil and monocyte activation, including ROS production and phagocytosis

  • Assess dendritic cell maturation and antigen presentation capacity

Research with Tp0965 demonstrated its ability to induce proinflammatory responses in endothelial cells, including increased expression of adhesion molecules (ICAM-1, E-selectin) and chemokines (MCP-1), which enhanced monocyte adhesion and transmigration. Similar comprehensive immune response profiling would be valuable for HflK .

What is the role of HflK in T. pallidum's ability to evade host immune responses?

This complex question requires multifaceted investigation:

  • Assess whether HflK interferes with complement activation or antibody recognition

  • Determine if HflK modulates phagocytosis efficiency or phagolysosome formation

  • Investigate potential interference with antigen presentation pathways

  • Evaluate effects on antimicrobial peptide resistance

  • Assess impact on host cell apoptosis or pyroptosis mechanisms

The ability of T. pallidum to persist despite robust immune responses suggests its proteins, including potentially HflK, may have evolved mechanisms to modulate host immunity. Research with other T. pallidum proteins has revealed immunomodulatory effects that contribute to pathogenesis .

How does post-translational modification affect HflK function and immunogenicity?

This sophisticated research question requires specialized techniques:

  • Mass spectrometry analysis to identify potential phosphorylation, glycosylation, or lipidation sites

  • Site-directed mutagenesis to create modification-deficient variants

  • Comparative functional assays between native and modification-deficient variants

  • Structural analysis to determine how modifications affect protein conformation

  • Immunological studies to assess how modifications impact recognition by the immune system

Post-translational modifications can significantly affect bacterial protein function and immunogenicity. For recombinant protein production, researchers must consider whether the expression system can reproduce relevant modifications found in native T. pallidum .

How can researchers overcome solubility issues with recombinant HflK?

Membrane proteins like HflK often present solubility challenges. Recommended approaches include:

  • Construct optimization:

    • Truncation of highly hydrophobic regions

    • Fusion with solubility-enhancing tags (MBP, SUMO)

    • Codon optimization for expression host

  • Expression conditions:

    • Reduced temperature (16-25°C)

    • Lower inducer concentrations

    • Co-expression with chaperones

  • Extraction and purification:

    • Screening different detergents (DDM, CHAPS, Triton X-100)

    • Inclusion of stabilizers (glycerol, specific lipids)

    • Refolding protocols from inclusion bodies if necessary

The experimental design should include systematic optimization of these parameters with small-scale test expressions before scaling up .

What controls are essential for validating HflK functional studies?

Rigorous experimental design requires appropriate controls:

  • Protein-specific controls:

    • Heat-inactivated recombinant HflK

    • Size-matched irrelevant recombinant protein

    • Endotoxin-free preparations (verified by LAL assay)

    • Dose-response and time-course analyses

  • Cell-based controls:

    • Unstimulated cells

    • Positive control stimuli (LPS, TNF-α)

    • Inhibitor controls for signaling studies

  • Technical controls:

    • Multiple technical and biological replicates

    • Different protein preparation batches to ensure reproducibility

In the Tp0965 studies, researchers included appropriate controls to confirm specificity of the observed effects, including dose-response and time-course analyses that demonstrated concentration-dependent and time-dependent effects on endothelial activation .

How can researchers differentiate between direct and indirect effects of HflK on host cells?

This methodological question requires sophisticated experimental approaches:

  • Direct binding assays:

    • Surface plasmon resonance with purified receptors

    • Cross-linking studies followed by mass spectrometry

    • FRET or proximity ligation assays in intact cells

  • Receptor blocking experiments:

    • Antibody blocking of candidate receptors

    • siRNA knockdown of receptor expression

    • Use of receptor-deficient cell lines

  • Signaling pathway analysis:

    • Rapid time-course studies (seconds to minutes)

    • Phosphoprotein analysis with phospho-specific antibodies

    • Pharmacological inhibitor studies with appropriate controls

Research with Tp0965 used inhibitor studies (ROCK inhibitor Y-27632) to investigate the mechanism of action, demonstrating that the protein's effects on endothelial permeability were partially mediated through the RhoA/ROCK pathway .

How does the immunomodulatory potential of HflK compare with other T. pallidum proteins?

This comparative question requires systematic analysis:

T. pallidum ProteinKnown Effects on Immune CellsKey MechanismsResearch Techniques
Tp0965Activates endothelial cells, increases monocyte adhesion and transmigrationUpregulates adhesion molecules (ICAM-1, E-selectin), induces F-actin reorganizationCell ELISA, RT-PCR, migration assays
Tp47Promotes immune cell migrationNot fully characterized in search resultsMigration assays
TpN17Known immunogenic proteinAntibody recognitionELISA, Western blot
TpN47Strong immunogenAntibody recognitionELISA, Western blot

While specific data on HflK's immunomodulatory effects is not available in the search results, this comparative framework provides a model for researchers to position new findings about HflK within the context of other T. pallidum proteins .

What structural similarities exist between HflK and other functionally characterized T. pallidum proteins?

Researchers investigating HflK should consider:

  • Domain architecture comparison:

    • Presence of signal sequences

    • Transmembrane domains

    • Functional motifs shared with other T. pallidum proteins

  • Structural modeling approaches:

    • Homology modeling based on solved structures

    • Molecular dynamics simulations to predict dynamic behavior

    • Protein-protein interaction prediction

  • Evolutionary analysis:

    • Phylogenetic comparison within Treponema species

    • Analysis of conserved regions across bacterial species

While specific structural data on HflK is not provided in the search results, this systematic approach allows researchers to position HflK within the broader context of T. pallidum proteins .

What technological advances could enhance our understanding of HflK's role in T. pallidum pathogenesis?

Emerging methodologies that could advance HflK research include:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize protein localization

    • Intravital imaging to track protein-host interactions in vivo

    • Cryo-EM for structural determination

  • Systems biology approaches:

    • Multi-omics integration (proteomics, transcriptomics, metabolomics)

    • Network analysis of host-pathogen interactions

    • Machine learning for pattern recognition in complex datasets

  • Advanced genetic tools:

    • CRISPR-based approaches for host cell receptor identification

    • Conditional expression systems for temporal control

    • Site-specific mutagenesis for structure-function analysis

These approaches could overcome the current limitations in studying T. pallidum proteins, which often rely on recombinant protein studies due to the challenges of culturing this bacterium in vitro .

How might HflK interact with other T. pallidum proteins in multiprotein complexes?

This complex research question requires specialized approaches:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with other T. pallidum proteins

    • Yeast two-hybrid or bacterial two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

  • Structural studies of protein complexes:

    • Cross-linking mass spectrometry

    • Single-particle cryo-EM

    • Native mass spectrometry

  • Functional characterization of complexes:

    • Co-expression studies

    • Activity assays with purified complexes

    • Mutational analysis of interaction interfaces

Understanding potential multiprotein complexes involving HflK could provide insights into its function in T. pallidum and identify new therapeutic targets .

What are the prospects for HflK as a diagnostic or vaccine target for syphilis?

This translational research question bridges basic and applied science:

  • Diagnostic potential assessment:

    • Evaluation of HflK immunogenicity during different disease stages

    • Assessment of antibody persistence after treatment

    • Comparison with current diagnostic antigens

    • Development of prototype assays (ELISA, lateral flow)

  • Vaccine potential investigation:

    • Analysis of conservation across T. pallidum strains

    • Epitope mapping to identify protective regions

    • Animal model testing of protective efficacy

    • Formulation and adjuvant optimization

  • Therapeutic targeting:

    • Identification of inhibitors that block HflK function

    • Assessment of antibody-mediated neutralization

    • Evaluation of combination approaches with other antigens

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.