Recombinant Treponema pallidum Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Treponema pallidum Protein Translocase Subunit SecD

Recombinant Treponema pallidum Protein translocase subunit SecD (secD) is a critical component of the protein translocation machinery in Treponema pallidum, the bacterium responsible for syphilis. This protein plays a pivotal role in the secretion of proteins across the bacterial membrane, which is essential for the organism's survival and pathogenicity. The SecD protein is part of the Sec pathway, a universally conserved system in bacteria that facilitates the translocation of newly synthesized proteins into or across membranes.

Function and Mechanism of SecD

Role in Protein Translocation

SecD functions primarily as a component of the protein translocase complex, which is responsible for transporting proteins that are synthesized in the cytoplasm to their functional destinations outside the cell membrane. This process is vital for maintaining cellular function and enabling the bacterium to interact with its environment, including host tissues during infection.

Mechanistic Insights

The SecD protein operates by forming a channel through which proteins can pass. It works in conjunction with other components of the Sec system, including SecA and SecB, to ensure that proteins are correctly folded and translocated efficiently. The energy required for this process is derived from ATP hydrolysis, which drives conformational changes necessary for translocation.

Amino Acid Sequence

The amino acid sequence of recombinant SecD from Treponema pallidum (strain Nichols) has been determined and is crucial for understanding its structure-function relationship. The sequence consists of 583 amino acids and contains several conserved regions that are characteristic of the RND (Resistance-Nodulation-Cell Division) superfamily, indicating its role in membrane transport.

Research Findings

Proteomic Studies

Recent proteomic analyses have identified secD as a significant player in the virulence of Treponema pallidum. For instance, research has shown that mutations in secD can lead to reduced virulence, highlighting its importance in pathogenicity .

Diagnostic Potential

The recombinant form of SecD has been explored for its potential use in serological diagnostics for syphilis. Studies have indicated that antibodies against SecD can be detected in patients with active infections, suggesting its utility as a biomarker .

Table 1: Characteristics of Recombinant Treponema pallidum Protein Translocase Subunit SecD

PropertyDetails
Gene NamesecD
OrganismTreponema pallidum subsp. pallidum Nichols
Amino Acid Length583
Molecular WeightApprox. 63 kDa
FunctionProtein translocation via Sec pathway
Pathogenic RoleEssential for virulence

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
secD; TP_0410; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
secD
Target Protein Sequence
MSKKARFGVVLVVLAACSGFLFPTLQWYFLTDAQTRQRALSSREQIKEYAVQSAERDLAD LTRLARAGSDEDISARYAPLVAAARQNLSYSGRPAPSRWTAAALVSAFPVKSEQGFVLYA RPLMEQTYREAVLKMKRRQAQAVKLGLDLSGGTSVVIKADLSEVTKGVPDAERAAIRSEA MALVLSTLENRINRFGLSEPVIRRQGEDRVYVEIPGLTDRDRVHSIVMGRGVLAFHLVDD DATQKLLDHYRNNPQGTFDAAHQLHDLSLVPEHTSVLGVYRKDSYGLDVRDGFLVVKKEP ALEGRHIRDATVSSGRANEPLVLFDLDHEGARIFSELTTKEIGRRLAIVSDGKIRSAPAI REPITAGSGSISGFSAEEAQNLKTALRSAWLNVALEIENQQVVGASMGEESIRQGTRALV WGLCAVLLFMLVWYQEAGVNACVAQLLNLYIMFGVLSAFNLTLTLSSIAGMILTIGMAVD ANVVVFERIREELALGKSRGAAVCSGFERAFWAIMDSNVTTFIAALFLSVLGTGPIKGFA YSLAIGVVSSVFTALFVSRLMFDYGTEVLHKKTVRIGWRIARV
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent action of SecA.
Database Links

KEGG: tpa:TP_0410

STRING: 243276.TP0410

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.