Recombinant Treponema pallidum Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Introduction to Treponema pallidum and Protein Translocase SecF

Treponema pallidum is a gram-negative spirochete bacterium responsible for syphilis, a sexually transmitted infection with significant public health impact worldwide. The organism belongs to a family of bacteria characterized by their spiral morphology and distinctive motility patterns. T. pallidum has several subspecies, including T. p. pallidum which causes syphilis, and T. p. pertenue which causes yaws . With a genome size of approximately 1139.3-1140.4 kb, T. pallidum has a relatively compact genetic footprint compared to many other pathogenic bacteria .

One of the most challenging aspects of T. pallidum research has been the inability to continuously culture the organism under laboratory conditions. Until recently, researchers were unable to maintain the spirochete in vitro, which significantly hampered investigations into its biology and pathogenesis . In 2018, a breakthrough occurred when researchers established a long-term culture system using rabbit epithelial cells, allowing for the propagation of treponemes that retain their characteristic structure, motility, multiplication rate, and infectivity .

The Protein translocase subunit SecF is an integral membrane protein that forms part of the Sec protein translocation system, a conserved bacterial machinery responsible for transporting proteins across the cytoplasmic membrane. In T. pallidum, the SecF protein is encoded by the secF gene (designated as TP_0411) and plays a crucial role in the bacterium's protein secretion processes .

Expression Systems and Methods

The production of Recombinant Treponema pallidum Protein translocase subunit SecF typically employs Escherichia coli as the expression host . This bacterial expression system offers several advantages for recombinant protein production, including rapid growth, high protein yields, and well-established genetic manipulation techniques.

To facilitate purification and detection, the recombinant SecF protein is commonly produced with affinity tags, such as an N-terminal hexahistidine (His) tag . This approach enables efficient purification using metal chelate affinity chromatography, a technique that has been successfully applied to other recombinant T. pallidum proteins .

The expression process generally follows these steps:

  1. PCR amplification of the secF gene from T. pallidum genomic DNA

  2. Insertion of the amplified DNA into an E. coli expression vector

  3. Transformation of the recombinant plasmid into competent E. coli cells

  4. Induction of protein expression under controlled conditions

  5. Cell lysis and extraction of the recombinant protein

  6. Purification of His-tagged SecF using metal chelate affinity chromatography

Research Applications

The availability of recombinant T. pallidum proteins, including SecF, has significantly advanced research into this challenging pathogen. These recombinant proteins serve as valuable tools for investigating the biology of T. pallidum, particularly aspects related to protein secretion, membrane organization, and host-pathogen interactions.

Research applications for Recombinant Treponema pallidum Protein translocase subunit SecF include:

  • Structural studies to determine the three-dimensional architecture of the protein

  • Functional assays to elucidate the protein's role in T. pallidum physiology and virulence

  • Interaction studies to identify binding partners and protein complexes within the Sec pathway

  • Development of inhibitors targeting the Sec system as potential therapeutic agents

Diagnostic Applications

While the specific diagnostic applications of SecF are not extensively documented, recombinant T. pallidum proteins have proven valuable for syphilis diagnosis. For example, the highly immunogenic lipoproteins TpN17, TpN47, and TpN44.5 have been used in enzyme-linked immunosorbent assays (ELISAs) with high diagnostic sensitivity .

In a study evaluating recombinant T. pallidum antigens for syphilis serology, assays combining multiple antigens demonstrated improved diagnostic sensitivity compared to single-antigen tests. These assays detected antibodies in 17 of 18 patients at all stages of syphilis, with no reactivity observed in normal human sera or sera from patients with Lyme borreliosis .

The potential utility of SecF in diagnostic applications would depend on its immunogenicity during natural infection and the presence of specific epitopes that elicit detectable antibody responses in syphilis patients.

Current Limitations in Research

Despite recent advances, research on T. pallidum remains challenging due to several factors:

  • The complex requirements for in vitro cultivation

  • The unique membrane architecture of the spirochete

  • Limited genetic manipulation tools compared to other bacterial systems

  • The need for specialized animal models for infectivity studies

These challenges underscore the importance of recombinant proteins like SecF for advancing our understanding of T. pallidum biology without the need to propagate large quantities of the pathogen itself.

Future Research Directions

Future research on Recombinant Treponema pallidum Protein translocase subunit SecF may focus on:

  • Determining high-resolution structures through X-ray crystallography or cryo-electron microscopy

  • Investigating the protein's interactions with other components of the Sec machinery

  • Exploring the role of SecF in T. pallidum's adaptation to different microenvironments within the host

  • Evaluating the protein's potential as a target for novel antimicrobial agents or as a component of diagnostic platforms

Recent advances in T. pallidum cultivation methods, including the development of fluorescent strains , may also facilitate new approaches to studying SecF function in living organisms, potentially yielding insights that cannot be obtained from recombinant protein studies alone.

Table 1: Key Properties of Recombinant Treponema pallidum Protein Translocase Subunit SecF

PropertyDetailsReference
Protein NameProtein translocase subunit SecF
Gene NamesecF
Locus NameTP_0411
UniProt AccessionO83426, E9RGS4
Source OrganismTreponema pallidum (strain Nichols)
Expression SystemE. coli
Fusion TagN-terminal His tag
Full Length420 amino acids
Recombinant Variant1-315 amino acids (partial)
Storage Recommendation-20°C (short-term), -20°C or -80°C (long-term)
Buffer CompositionTris-based buffer, 50% glycerol

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference for your own formulations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
secF; TP_0411; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-420
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
secF
Target Protein Sequence
MRQVVRFSLLFLPCAILSVVLIGAGVLRWALWGMSFGIDFQSGLIERLRIAPPAFSLVYT GTQSMQFFQDEQKVVFTVSSPGVLGERYEFLYTEYPTLRAFSEGAKKVEHLSVTLHAPET VYMRDTFSGAEGSTLSSASCFVHYFSEDVRAPGVEELRRVLKDVPSAVVQQVGVRAEHTF QVRVAAETAFPSSLLPEQGGTALAQSDAPDLVTPQGAVESVVYAALVRAYGADHVVRLAM DFVGSRFSHLLVRQALLLVLGALVLIFLYVALRFRWFFALGAIVALVHDACIMVSFMVWF GLEFNSASIAAILTIIGYSINDTVVVFDRVRQTILLDPIASVTTVLDRSQTDMLTRTVVT TVTTLLAALMLYVFTEGGSRDFSLALMVGMVSGVYSTIYIAGGCIALISRGKSGGQLLGL
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links

KEGG: tpa:TP_0411

STRING: 243276.TP0411

Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Treponema pallidum SecF protein?

Treponema pallidum SecF (TP_0411) is a membrane protein that functions as part of the bacterial protein secretion machinery. The protein contains:

  • A predicted N-terminal signal sequence (residues 1-60), which is unusually long compared to conventional signal peptides

  • Several hydrophobic transmembrane segments that anchor the protein in the bacterial cell membrane

  • A complete amino acid sequence that includes a highly hydrophobic central region (F18-F52, GRAVY value = 1.166) compared to the mature protein (GRAVY value = -0.220)

  • Structural domains with both conserved and variable regions across Treponema species

The protein belongs to the SecYEG-SecA protein translocation system and plays a crucial role in protein transport across the bacterial membrane, which is essential for T. pallidum pathogenesis and survival.

How is recombinant T. pallidum SecF protein expressed and purified for research applications?

Methodological approach for expression and purification:

  • Expression System Selection:

    • E. coli is the predominant expression system, enabling high-level production of recombinant T. pallidum proteins

    • Insertion of PCR-amplified DNA into appropriate E. coli expression vectors

  • Vector Design Considerations:

    • Inclusion of N-terminal hexahistidine tags to facilitate purification

    • Selection of appropriate promoters for optimal expression

  • Purification Protocol:

    • Metal chelate affinity chromatography using the His-tag is the primary purification method

    • Typical purity of >85-90% can be achieved as determined by SDS-PAGE

  • Storage and Stability:

    • Recommended storage in Tris-based buffer with 50% glycerol at -20°C/-80°C

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles to maintain protein integrity and function

What are the functional roles of SecF in Treponema pallidum pathogenesis?

SecF contributes to T. pallidum pathogenesis through several mechanisms:

  • Protein Translocation:

    • As part of the Sec translocase complex, SecF facilitates the export of virulence factors and membrane proteins across the cytoplasmic membrane

    • This function is critical for maintaining the unique cell envelope ultrastructure of T. pallidum, which differs significantly from conventional Gram-negative bacteria

  • Cell Envelope Biogenesis:

    • T. pallidum has a distinctive peptidoglycan layer that is chemically distinct, thinner, and more distal to the outer membrane compared to other Gram-negative bacteria

    • Protein translocation machinery, including SecF, plays an essential role in coordinating the assembly of this unusual cell envelope

  • Contribution to Immune Evasion:

    • The specialized cell envelope structure, partially dependent on SecF function, contributes to the pathogen's ability to evade host immune responses

    • This may relate to the observation that message levels of certain T. pallidum membrane proteins increase in parallel to host immune pressure

How does SecF interact with other components of the T. pallidum protein translocation machinery?

The SecF protein functions as part of a complex protein translocation system:

  • Component Interactions:

    • SecF works in coordination with SecD and other components of the SecYEG translocon

    • Together with SecD, SecF forms a complex that enhances the efficiency of protein translocation by interacting with the SecA ATPase and the SecYEG channel

  • Structural Basis for Interactions:

    • The multi-modular architecture of T. pallidum membrane proteins facilitates specific interactions between different components of the translocation machinery

    • Domain organization analysis suggests specific regions responsible for protein-protein interactions within the complex

  • Energy Coupling:

    • SecF contributes to the coupling of energy (ATP hydrolysis by SecA) to the mechanical work of protein translocation

    • This process is essential for the export of proteins that contribute to the structural integrity of the T. pallidum cell envelope

What are the optimal experimental conditions for functional studies of recombinant T. pallidum SecF?

Key experimental parameters for functional studies:

  • Buffer Composition:

    • Tris-based buffers (pH 7.4-8.0) with appropriate salt concentrations are commonly used

    • Addition of stabilizing agents such as glycerol (5-50%) improves protein stability

  • Storage Considerations:

    • For short-term use: Store working aliquots at 4°C for up to one week

    • For long-term storage: Maintain at -20°C to -80°C in buffer containing 50% glycerol

    • Lyophilization may be used for extended stability

  • Reconstitution Protocol:

    • Briefly centrifuge vials prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • For functional studies, reconstitution into lipid bilayers or detergent micelles may be necessary to maintain native conformation

  • Experimental Applications:

    • Immunological studies: ELISA, Western blotting, and immunogen preparation

    • Protein-protein interaction studies: Pull-down assays, co-immunoprecipitation

    • Structural studies: Crystallography or cryo-electron microscopy

How does T. pallidum SecF differ from homologous proteins in other bacterial species?

Comparative analysis reveals several distinguishing features:

  • Sequence Divergence:

    • T. pallidum SecF shows notable sequence divergence from SecF proteins of conventional Gram-negative bacteria

    • This divergence reflects the phylogenetic distance of T. pallidum from other bacterial groups

  • Domain Organization:

    • Analysis indicates that T. pallidum membrane proteins often contain domains that are found together in all orthologs from pathogenic treponemes but are not observed together in genera outside Treponema

    • This unique domain architecture may contribute to the specialized function of SecF in the T. pallidum cellular context

  • Functional Adaptations:

    • The divergent structure of T. pallidum SecF likely reflects adaptations to the unique ultrastructure of the T. pallidum cell envelope

    • These adaptations may include specialized interactions with other T. pallidum-specific proteins

What methods are used to evaluate the immunogenicity of T. pallidum SecF?

Evaluation of immunogenic properties involves several experimental approaches:

How does the expression of SecF relate to different stages of T. pallidum infection?

The temporal expression pattern of SecF and its relationship to infection stages:

  • Transcriptional Profiling:

    • Message quantification studies of T. pallidum membrane proteins show variations in expression levels during experimental infection

    • For some membrane proteins, message levels increase in parallel to host immune pressure, suggesting a role in pathogen persistence

  • Stage-Specific Expression:

    • The expression patterns of certain T. pallidum proteins correlate with different stages of syphilis (primary, secondary, latent, tertiary)

    • Understanding these patterns is important for developing diagnostics that can differentiate between disease stages

  • Response to Environmental Conditions:

    • Expression may be modulated by environmental factors encountered during infection, including nutrient availability, pH, temperature, and host immune responses

What challenges exist in studying recombinant T. pallidum SecF and other membrane proteins?

Several technical challenges complicate research on T. pallidum membrane proteins:

  • Expression Difficulties:

    • Membrane proteins like SecF are often challenging to express in heterologous systems due to toxicity and improper folding

    • Overexpression of some T. pallidum membrane proteins in E. coli can lead to aberrant cell morphology and cytoplasm extrusion

  • Cultivation Limitations:

    • T. pallidum remains difficult to culture in vitro, limiting the availability of native protein for study

    • Researchers often rely on animal models (rabbits) to obtain spirochetes, which is costly and yields limited material

  • Structural Complexity:

    • The multi-domain architecture and membrane-embedded nature of proteins like SecF present challenges for structural characterization

    • Special consideration must be given to maintaining native conformation during purification and analysis

  • Functional Reconstitution:

    • Demonstrating the functional activity of recombinant membrane proteins often requires reconstitution into artificial membrane systems

    • These systems may not fully recapitulate the unique environment of the T. pallidum cell envelope

How can recombinant T. pallidum SecF contribute to syphilis diagnostics and vaccine development?

Potential applications in diagnostics and vaccine development:

  • Diagnostic Applications:

    • Recombinant T. pallidum proteins have significantly improved syphilis serological diagnostics

    • Combined use of several recombinant antigens has shown high sensitivity and specificity in diagnostic tests

    • Novel recombinant antigens, including membrane proteins, could enhance the ability to differentiate between disease stages or cured syphilis

  • Vaccine Development Considerations:

    • T. pallidum membrane proteins are potential targets for vaccine development due to their surface exposure and role in pathogenesis

    • Understanding the immunogenicity and conservation of proteins like SecF across T. pallidum strains is crucial for vaccine design

    • The development of attenuated strains for vaccine research requires comprehensive knowledge of T. pallidum ultrastructure

  • Methodological Approach:

    • Systematic cloning and expression of T. pallidum open reading frames has enabled the identification of novel antigens with potential for diagnostics and vaccines

    • A proteomics approach is being developed to identify proteins important for T. pallidum host-pathogen interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.