Recombinant Treponema pallidum Putative zinc metalloprotease TP_0600 (TP_0600)

Shipped with Ice Packs
In Stock

Description

Introduction to Treponema pallidum TP_0600

Treponema pallidum is a spirochete bacterium that causes syphilis, a highly invasive pathogen capable of attaching to host cells and invading tissue . One of the proteins expressed by T. pallidum during infection is TP_0600, a putative zinc metalloprotease . Metalloproteases are enzymes that require a metal ion, such as zinc, to function and catalyze the hydrolysis of peptide bonds in proteins . TP_0600 is thought to play a role in the bacterium's pathogenesis, potentially aiding in its dissemination and tissue invasion .

Characteristics of TP_0600

TP_0600 is a metalloprotease that binds zinc, a characteristic that can be inhibited by metalloprotease inhibitors . Metalloproteases, like TP_0600, contain a metal-binding motif with the consensus sequence HEXXH . This motif is crucial for the enzyme's catalytic activity. For example, Treponema pallidum extracellular matrix-binding adhesin Tp0751 is a zinc-dependent protease whose proteolytic activity can be abolished by the metalloprotease inhibitor 1,10-phenanthroline .

The Structure of TP_0600

The structure of Treponema pallidum Tp0624, a protein with an OmpA-like domain, reveals a multi-modular architecture comprised of three distinct domains . These include a C-terminal divergent OmpA-like domain and a previously uncharacterized tandem domain unit . The three domains are found in all orthologs from pathogenic treponemes but are not observed together in genera outside Treponema .

Function and Activity

TP_0600's function relates to its proteolytic activity. T. pallidum employs this metalloprotease to degrade host components, which facilitates bacterial dissemination and tissue invasion during infection . For example, another T. pallidum protease, Pallilysin, is a host component-binding metalloprotease that coordinates zinc via an HEXXH motif . Mutation of the HEXXH active site residues abolishes host component proteolysis but does not adversely affect host component binding, confirming the bifunctionality of pallilysin .

Inhibitors of TP_0600

The activity of zinc metalloproteases can be inhibited by specific compounds. For example, 1,10-phenanthroline is a zinc chelator that abolishes the fibrinogenolytic activity of the Treponema pallidum extracellular matrix-binding adhesin Tp0751 . Similarly, peptidomimetic metalloprotease inhibitors can inhibit the shedding of VSG during differentiation, indicating the involvement of a zinc metalloprotease .

Role in Pathogenesis

As a zinc metalloprotease, TP_0600 likely contributes to the pathogenesis of T. pallidum by degrading host proteins and disrupting tissue structures . The highly invasive and disseminating nature of T. pallidum likely represents a multi-factorial process . Factors mediating this pathogenic trait may include treponemal adhesion, motility, chemotaxis, unusual ultrastructure/low outer-membrane protein content, host-inflammatory and immune responses, and antigenic variation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TP_0600; Putative zinc metalloprotease TP_0600
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0600
Target Protein Sequence
MIKIIIGVVVLGIVVLFHELGHFVAALWCRVEVLSFSVGMGPVLFRKKFGKTEYRLSMLP LGGYCGMKGEQAFQTALDQKLSRIPVEPGSLYAVGPLKRMGIAFAGPLANVLMAVMVLAL VSALGSRVHTFGNRISPVYVYDSSDNSPARRVGLQDGDTILRIGDQPIRYFSDIQKIVSQ HAQRALPFVIERRGQLMHVTITPDRDAHTGMGRVGIYHYVPLVVAAVDAHGAASRAGLEP EDKILAVAGRRVQHAVQLLALLKEFRKKSVVLTVLRSGKRRYHTIALVRTENGAIDVGIE WKAHTVVIPGTSFFASVRAGIAETLRMCVLTVKGIGMLFRGLQFQQAISGPLRITHVIGD VAQHGFQESFLTGLSQLCEFVALVCVSLFIMNLLPIPILDGGLILFACVELFMQRSIHPR VLYYLQFVGFAFVALIFLCAFWNDVNFLFH
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0600

STRING: 243276.TP0600

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is TP_0600 and what is its role in Treponema pallidum?

TP_0600 is a putative zinc metalloprotease from Treponema pallidum, the causative agent of syphilis. It is a 450-amino acid protein (molecular weight approximately 50 kDa) classified as EC 3.4.24.- (metalloendopeptidases) . While the precise biological function remains under investigation, it belongs to a class of enzymes that typically catalyze the hydrolysis of peptide bonds using a metal ion (zinc) in the active site. Metalloproteases often play crucial roles in bacterial pathogenesis, including tissue invasion, immune evasion, and nutrient acquisition .

What are the predicted structural features of TP_0600?

The protein contains several key structural elements:

  • An N-terminal signal peptide/transmembrane domain (approximately first 30 residues)

  • The catalytic metalloprotease domain containing the zinc-binding motif

  • Membrane-associated regions

  • Potential substrate-binding regions

Structural prediction programs suggest that TP_0600 has both soluble and membrane-associated domains, consistent with its role as a membrane-anchored protease .

What expression systems are optimal for recombinant TP_0600 production?

The most successful expression system for TP_0600 is Escherichia coli, particularly when using auto-induction media for protein expression. Based on experimental approaches for similar metalloproteases:

Recommended protocol:

  • Clone the TP_0600 gene into an expression vector with a His-tag (e.g., pET28a)

  • Transform into E. coli BL21(DE3) strain

  • Culture in ZYM auto-inducing media at 25°C for 3 days or in LB media with 0.1 mM IPTG induction at 25°C for 24h

  • Harvest cells and lyse by sonication in binding buffer (20 mM Tris-HCl, 300 mM NaCl, 10 mM imidazole, pH 8.0)

  • Purify using Ni-NTA affinity chromatography

Alternative expression systems include yeast, baculovirus, or mammalian cells, which may be beneficial for proper folding and post-translational modifications .

What purification challenges are associated with TP_0600?

Purification of TP_0600 presents several challenges:

  • Solubility issues: The protein may form inclusion bodies when overexpressed in E. coli

  • Membrane association: The hydrophobic regions can cause aggregation

  • Zinc dependency: Maintaining proper metal coordination during purification

Recommended approach:

  • For inclusion body purification: Solubilize in buffer containing 8M urea or 6M guanidine-HCl, then refold by gradual dialysis

  • For soluble protein: Purify under native conditions with protease inhibitors and 1-5 mM zinc chloride in the buffer

  • Consider using mild detergents (0.1% Triton X-100) to maintain solubility

How can you verify the purity and activity of recombinant TP_0600?

Multiple analytical methods should be employed:

For purity assessment:

  • SDS-PAGE (expected size ~50 kDa)

  • Western blotting using anti-His antibodies

  • Size exclusion chromatography

For proper folding verification:

  • Circular dichroism spectroscopy

  • Thermal shift assays with differential scanning fluorimetry (DSF)

  • Limited proteolysis

For activity confirmation:

  • Zinc binding assay using isothermal titration calorimetry

  • Enzymatic activity assays using synthetic peptide substrates

  • Metalloprotease activity test with and without EDTA as inhibitor

How can the enzymatic activity of TP_0600 be measured?

Several approaches can be used to measure TP_0600 enzymatic activity:

Fluorogenic peptide substrates:

  • Use commercially available FRET peptides containing a quencher and fluorophore

  • Enzymatic cleavage separates these components, resulting in increased fluorescence

  • Reaction conditions: 50 mM Tris-HCl, pH 7.6, 150 mM NaCl, 10 μM ZnCl₂, 37°C

Metal dependency testing:

  • Prepare apo-protein by incubation with 20 mM EDTA followed by buffer exchange

  • Test activity after reconstitution with different metals (Zn²⁺, Cu²⁺, Ni²⁺)

  • Compare activity levels to determine metal specificity

A representative protocol for activity testing is shown in the table below:

SampleBufferMetal additionSubstrateActivity (% of max)
TP_060050 mM Tris pH 7.6NoneFluorogenic peptide<5%
TP_060050 mM Tris pH 7.610 μM ZnCl₂Fluorogenic peptide100%
TP_060050 mM Tris pH 7.610 μM CuCl₂Fluorogenic peptide~20%
TP_060050 mM Tris pH 7.610 μM NiCl₂Fluorogenic peptide~10%
TP_0600 + EDTA50 mM Tris pH 7.610 μM ZnCl₂Fluorogenic peptide~90%

What are potential natural substrates for TP_0600?

While specific natural substrates for TP_0600 remain to be definitively identified, predicted substrates based on studies of similar bacterial metalloproteases include:

  • Host extracellular matrix proteins: Fibronectin, collagen, laminin

  • Host immune components: Immunoglobulins, complement proteins

  • Host cell surface receptors: Adhesion molecules, cytokine receptors

To identify natural substrates experimentally:

  • Incubate purified TP_0600 with potential substrate proteins

  • Analyze cleavage products by SDS-PAGE or mass spectrometry

  • Confirm specificity by using site-directed mutants with impaired catalytic activity

  • Validate in physiological context using cell culture models

How does metal binding affect TP_0600 structure and function?

Metal binding, particularly zinc, is crucial for TP_0600 function. Based on studies of related metalloproteases:

  • Structural changes: Zinc binding induces conformational changes that properly orient catalytic residues

  • Thermal stability: Metallated TP_0600 shows increased thermal stability compared to apo-protein

  • Enzyme kinetics: Proper metal coordination is essential for optimal catalytic activity

Experimental approaches to study metal effects:

  • Differential scanning fluorimetry to measure thermal stability (ΔTm) with/without zinc

  • Nuclear magnetic resonance (NMR) to detect structural changes upon metal binding

  • Enzyme kinetics (kcat, KM) determinations under varying metal concentrations

What evidence supports TP_0600's role in T. pallidum pathogenesis?

Several lines of evidence implicate TP_0600 in T. pallidum pathogenesis:

  • Genomic studies: TP_0600 is conserved across pathogenic Treponema strains

  • Expression analysis: The gene is transcribed during experimental infection

  • Functional predictions: As a metalloprotease, it may degrade host proteins and tissues

  • Comparative genomics: Similar metalloproteases in other pathogens contribute to virulence

  • Comparing TP_0600 expression between virulent and attenuated strains

  • Studying the protein's ability to cleave host defense molecules in vitro

  • Developing antibodies against TP_0600 to test neutralization of T. pallidum pathogenicity in animal models

How might TP_0600 interact with the host immune system?

TP_0600 could interact with the host immune system in several ways:

  • Degradation of immune molecules: Potential cleavage of antibodies, complement components, or cytokines

  • Modulation of immune signaling: Processing of cytokines or cytokine receptors

  • Antigen presentation: As a surface-exposed protein, it may be recognized by host antibodies

Research approaches to investigate these interactions include:

  • Testing recombinant TP_0600 against purified immune components (IgG, complement, cytokines)

  • Examining host immune responses to TP_0600 in experimental syphilis

  • Evaluating antibody responses to TP_0600 in syphilis patients

Could TP_0600 serve as a diagnostic marker or vaccine candidate for syphilis?

TP_0600 may have potential as a diagnostic marker or vaccine candidate based on several considerations:

As a diagnostic marker:

  • Recombinant TP_0600 could be incorporated into ELISA-based serodiagnostic tests

  • Performance should be compared with established antigens like Tp0100, which shows high sensitivity (95.6%) and specificity (98.1%)

As a vaccine candidate:

  • Being a putative surface-exposed protein, it could be accessible to antibodies

  • Conserved regions among T. pallidum strains might provide broad protection

  • Metalloprotease activity might be neutralized by antibodies, potentially reducing virulence

Research approach:

  • Evaluate seroprevalence against TP_0600 in different stages of syphilis

  • Compare immunogenicity of different TP_0600 domains

  • Test protective efficacy of anti-TP_0600 antibodies in rabbit models of infection

What are optimal approaches for site-directed mutagenesis of TP_0600?

For structure-function studies, strategic site-directed mutagenesis is essential:

Key residues to target:

  • Predicted metal-binding motif (HEXXH) residues

  • Catalytic glutamate residue

  • Substrate-binding pocket residues

  • Membrane-association domains

Recommended protocol:

  • Use PCR-based mutagenesis with overlapping primers containing desired mutations

  • Confirm mutations by DNA sequencing

  • Express and purify mutant proteins alongside wild-type for comparison

  • Characterize effects on folding, stability, metal binding, and enzymatic activity

Expected outcomes from key mutations based on studies of similar metalloproteases:

How can structural biology approaches enhance understanding of TP_0600?

Several structural biology approaches can provide insights into TP_0600 function:

X-ray crystallography:

  • Challenges: Obtaining diffraction-quality crystals of membrane-associated proteins

  • Solutions: Use truncated soluble domains, fusion with crystallization chaperones, lipidic cubic phase crystallization

  • Expected outcomes: High-resolution structure of catalytic domain with bound zinc and/or substrates

Cryo-electron microscopy:

  • Advantages: Can handle larger, membrane-associated proteins without crystallization

  • Approach: Purify TP_0600 in detergent micelles or nanodiscs

  • Resolution expectations: 3-4 Å resolution possible for well-behaved samples

Nuclear Magnetic Resonance (NMR):

  • Best suited for: Studying dynamic aspects, metal binding, substrate interactions

  • Sample requirements: 15N/13C-labeled protein (see methods in search result )

  • Types of experiments: HSQC for metal binding studies, relaxation experiments for dynamics

What are the advantages of different heterologous expression systems for TP_0600?

Different expression systems offer distinct advantages for TP_0600 production:

Expression SystemAdvantagesDisadvantagesOptimal Applications
E. coliHigh yields, simple culture, cost-effectiveInclusion body formation, lack of post-translational modificationsBasic biochemical studies, antigen production for antibodies
Yeast (P. pastoris)Proper folding, some post-translational modifications, high density cultureLonger production time, glycosylation patterns differ from mammalianStructure-function studies requiring proper folding
Baculovirus/insect cellsNear-native protein folding, post-translational modificationsHigher cost, lower yields, technical complexityFunctional studies requiring authentic protein structure
Mammalian cellsMost authentic post-translational modificationsHighest cost, lowest yields, most complexStudies on protein-host interactions requiring native protein

For most academic research purposes, E. coli expression with optimization for soluble protein production offers the best balance of yield, cost, and functionality. Key strategies include:

  • Lowering expression temperature (16-25°C)

  • Using specialized E. coli strains (Rosetta, Origami) for disulfide bond formation

  • Co-expression with chaperones

  • Adding zinc to the culture medium (10-50 μM ZnCl₂)

  • Using fusion tags that enhance solubility (SUMO, MBP)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.