Recombinant Treponema pallidum Uncharacterized protein TP_0070 (TP_0070)

Shipped with Ice Packs
In Stock

Description

Research Applications

TP_0070 is primarily utilized in:

  • Antigen Production: Used in ELISA kits for antibody detection studies .

  • Structural Studies: Its full-length expression facilitates crystallography and epitope mapping .

  • Host-Pathogen Interaction Assays: Potential role in adhesion or immune evasion mechanisms, analogous to other T. pallidum adhesins like Tp0751 (a laminin-binding protein critical for vascular dissemination) .

Diagnostic Potential

While TP_0070 itself is not yet validated for clinical diagnostics, recombinant T. pallidum proteins such as TpN17 and TmpA have demonstrated high diagnostic accuracy (sensitivity: 97.2%, specificity: 100%) . TP_0070’s use in research ELISAs suggests comparable potential, though cross-reactivity studies are pending .

Functional Insights

Hypothesized Roles:

  • Immunogenicity: Shares features with other T. pallidum antigens (e.g., TpN47, TmpA) that trigger robust antibody responses .

  • Pathogenicity: May contribute to tissue invasion or immune modulation, similar to TP_0751’s interaction with the 67-kDa laminin receptor (LamR) .

Limitations:

  • No direct evidence of enzymatic activity or host receptor binding has been published.

  • Functional redundancy with other T. pallidum proteins complicates mechanistic studies .

Comparative Analysis of T. pallidum Recombinant Proteins

ProteinFunctionDiagnostic SensitivityKey Interaction/Feature
TP_0070UncharacterizedUnder investigationFull-length expression in E. coli
Tp0751Laminin adhesion, metalloproteaseN/ABinds LamR receptor
TpN17Immunodominant antigen97.2% High specificity (100%)
TmpAMembrane lipoprotein90.6% Cross-reactivity with HIV/HTLV

Future Directions

  • Functional Characterization: Knockout studies or heterologous expression in model spirochetes could clarify TP_0070’s role in syphilis pathogenesis .

  • Diagnostic Validation: Large-scale serological testing is needed to assess TP_0070’s utility in syphilis screening panels .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you may have specific requirements. If so, please indicate your preferred format during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To preserve product integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to meet your specific needs. If you require a particular tag type, please inform us and we will prioritize development accordingly.
Synonyms
TP_0070; Uncharacterized protein TP_0070
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0070
Target Protein Sequence
MLPFYFLSVATNAAIGFILTVLDSQEESAHDCPFLYDATFSLVLALLSGIAAVCKCVNPI GAQLPVLGDLIPTLAGGTGCALFLHRYCVALSKPSPIPRTLVQYAKPLGLFSLAASILHL LFAPTLFL
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0070

STRING: 243276.TP0070

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Treponema pallidum protein TP_0070 and why is it significant for research?

TP_0070 is an uncharacterized protein from Treponema pallidum subspecies pallidum, the bacterium responsible for syphilis. While its specific function remains undetermined, studying this protein is valuable because uncharacterized proteins often play critical roles in bacterial pathogenesis and survival. Research on TP_0070 contributes to the broader understanding of T. pallidum biology, which has been historically challenging due to difficulties in cultivating and genetically manipulating this organism. Recent advances in the cultivation and genetic manipulation of T. pallidum have opened new possibilities for studying previously uncharacterized proteins . Similar to characterized proteins like Tp0100 and Tp1016, TP_0070 could potentially serve as a diagnostic antigen or vaccine candidate if found to be immunogenic and consistently expressed across different T. pallidum strains .

How does TP_0070 compare to other characterized T. pallidum proteins in terms of research complexity?

While specific comparisons to TP_0070 are not available in the current literature, research on uncharacterized T. pallidum proteins typically faces similar challenges as those encountered with better-studied proteins like Tp0100 and Tp1016. Tp0100, a putative thioredoxin, and Tp1016, a basic membrane protein, have been successfully expressed and purified as recombinant proteins, demonstrating good immunoreactivity with sera from infected hosts . The complexity of working with TP_0070 likely parallels these proteins, particularly regarding expression system selection, optimization of soluble protein production, and functional characterization. The research pathway typically involves gene amplification from T. pallidum genomic DNA, cloning into appropriate expression vectors, protein expression (often in E. coli), purification, and subsequent functional and immunological analysis . The challenge with uncharacterized proteins lies in the absence of known functions to guide experimental design and validation.

What bioinformatic approaches should be employed before experimental work with TP_0070?

Prior to laboratory work, comprehensive bioinformatic analysis of TP_0070 should be conducted to guide experimental design. This process should include:

  • Sequence homology analysis using BLAST and HHpred to identify potential functional domains and related proteins across bacterial species

  • Protein structure prediction using AlphaFold or similar tools to generate hypothetical 3D models

  • Subcellular localization prediction using tools like PSORTb and CELLO

  • Analysis of potential posttranslational modifications using NetPhos, NetOGlyc, and similar tools

  • Assessment of antigenicity and epitope prediction using tools like BepiPred and IEDB Analysis Resource

These computational analyses provide crucial preliminary data that can inform expression strategy selection, purification approach, and functional assays. For instance, if TP_0070 is predicted to be membrane-associated like Tp1016, different expression conditions may be required compared to cytoplasmic proteins like Tp0100 . Additionally, identification of potential functional domains can guide the design of specific activity assays to characterize the recombinant protein once successfully expressed.

What expression systems are most suitable for recombinant TP_0070 production?

Based on successful expression of other T. pallidum proteins, several expression systems could be suitable for TP_0070, each with distinct advantages:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coli BL21(DE3)High yield, cost-effective, extensive toolkit availableLimited post-translational modifications, potential inclusion body formationCodon optimization may be necessary; fusion tags (His, GST, MBP) can improve solubility
Insect cell systemBetter folding of complex proteins, improved solubilityHigher cost, longer production timeSuitable if mammalian-like glycosylation is required
Cell-free systemRapid production, suitable for toxic proteinsLower yield, higher costUseful for initial screening before scale-up
Mammalian cellsMost authentic post-translational modificationsHighest cost, most complexOnly necessary if specific mammalian modifications are critical

For initial attempts, E. coli BL21(DE) with a His-tag system would be recommended, as it has proven successful for other T. pallidum proteins such as Tp0100 and Tp1016 . The gene can be amplified from genomic DNA using PCR with appropriate restriction sites incorporated into primers, then cloned into an expression vector like pET28a . Expression conditions should be optimized systematically through factorial design approaches to maximize soluble protein yield .

How can experimental design optimize soluble expression of TP_0070?

To maximize soluble expression of TP_0070, a factorial design approach similar to that used for pneumolysin expression can be employed . This systematic methodology allows for the simultaneous evaluation of multiple variables affecting protein expression. Key parameters to optimize include:

  • Induction temperature (typically testing 16°C, 25°C, and 37°C)

  • IPTG concentration (ranging from 0.1 mM to 1.0 mM)

  • Induction time (2-24 hours)

  • Media composition (testing different nitrogen and carbon sources)

  • Cell density at induction (OD600 of 0.6-1.0)

  • Co-expression with chaperones if inclusion body formation occurs

A 2^n factorial design would efficiently identify optimal conditions while minimizing experimental runs. For example, a quarter-factorial design could reduce a 2^8 full factorial (256 conditions) to 64 experimental conditions without significant loss of information . The primary response variable should be soluble protein yield, which can be assessed by SDS-PAGE analysis of the soluble fraction after cell lysis.

For T. pallidum proteins, starting with conditions similar to those optimized for Tp0100 (which was expressed in inclusion body form) or Tp1016 (expressed in soluble form) would be reasonable . Based on the research cited, induction at 25°C with 0.1 mM IPTG for 4 hours in a medium containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, and 1 g/L glucose has shown good results for other recombinant proteins .

What purification strategies are most effective for recombinant T. pallidum proteins like TP_0070?

Effective purification of recombinant TP_0070 would likely involve a multi-step approach, informed by the protein's predicted properties. Based on successful strategies for other T. pallidum proteins, the following purification workflow is recommended:

  • Initial capture: If expressed with a His-tag (as commonly done with T. pallidum proteins), immobilized metal affinity chromatography (IMAC) using Ni-NTA agarose beads provides an efficient first step . Optimization of imidazole concentration in binding, washing, and elution buffers is crucial to maximize purity.

  • Intermediate purification: Size exclusion chromatography (SEC) or ion exchange chromatography (IEX) based on the protein's predicted isoelectric point. SEC has the added advantage of providing information about the oligomeric state of the protein.

  • Polishing: If the protein is intended for structural studies or sensitive functional assays, a final polishing step using high-resolution techniques like hydrophobic interaction chromatography (HIC) may be necessary.

For proteins expressed as inclusion bodies (as might be the case for TP_0070 based on other T. pallidum proteins like Tp0100), additional steps include:

  • Solubilization using denaturing agents (6-8M urea or 6M guanidine hydrochloride)

  • Refolding through dialysis with gradually decreasing denaturant concentration

  • Addition of stabilizing agents like glycerol, arginine, or low molecular weight additives during refolding

Protein purity should be assessed at each step using SDS-PAGE, and final purity determination should employ multiple methods including SDS-PAGE, Western blotting, and potentially mass spectrometry . For Tp0100 and Tp1016, purities exceeding 96% were achieved using Ni-NTA purification followed by quality control analyses .

What experimental methods are recommended for elucidating the structure of TP_0070?

Structural characterization of TP_0070 would require a multi-technique approach to build a comprehensive understanding of its three-dimensional conformation. The following methodologies are recommended, progressing from lower to higher resolution techniques:

Additionally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide information about protein dynamics and solvent accessibility, complementing static structural data. A hybrid approach combining multiple techniques would likely yield the most comprehensive structural understanding of this uncharacterized protein.

How can the biological function of TP_0070 be systematically investigated?

Determining the function of an uncharacterized protein like TP_0070 requires a systematic, hypothesis-driven approach combining in silico predictions with experimental validation. The following framework is recommended:

  • Functional prediction: Begin with computational predictions of binding partners, enzymatic activities, or cellular roles based on sequence and structural homology.

  • Protein-protein interaction studies:

    • Pull-down assays using tagged TP_0070 to identify binding partners

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to confirm and quantify specific interactions

    • Bacterial two-hybrid screens to identify potential interactors in a cellular context

  • Enzymatic activity screening:

    • Test predicted enzymatic functions using appropriate biochemical assays

    • Conduct substrate screening if the protein family suggests catalytic activity

  • Cellular localization studies:

    • Express fluorescently tagged versions (similar to the GFP-tagged T. pallidum strains mentioned in the research) to determine subcellular localization

    • Use immunogold electron microscopy with antibodies against the recombinant protein

  • Knockout/knockdown studies:

    • If genetic manipulation is possible, create knockout or knockdown strains to observe phenotypic changes

    • Complement with the wild-type gene to confirm phenotype specificity

  • Host-pathogen interaction analysis:

    • Test for interactions with host proteins and cellular components

    • Investigate immunological responses to the recombinant protein

The fluorescent tagging approach demonstrated for T. pallidum would be particularly valuable, allowing visualization of protein localization during infection and interaction with host cells . Each experimental result should refine the functional hypothesis, gradually building a more complete understanding of TP_0070's role in T. pallidum biology.

What approaches can determine if TP_0070 has potential as a diagnostic antigen?

To evaluate TP_0070's potential as a diagnostic antigen, a systematic immunological assessment should be conducted, similar to the approaches used for Tp0100 and Tp1016 . The following methodology is recommended:

  • Initial immunoreactivity screening:

    • Western blotting analysis using sera from:

      • T. pallidum-infected rabbits

      • Patients with different stages of syphilis (primary, secondary, latent, tertiary)

      • Healthy controls

      • Individuals with potentially cross-reactive infections

    This initial screening would confirm whether TP_0070 is expressed during infection and is recognized by the host immune system .

  • Development of diagnostic assay prototypes:

    • Enzyme-linked immunosorbent assay (ELISA) using purified recombinant TP_0070

    • Chemiluminescence immunoassay (CIA) formats

    For each format, optimization of antigen concentration, buffer conditions, and detection systems would be required.

  • Comprehensive validation with clinical samples:

    • Testing large panels of serum samples (300+ as in the Tp0100/Tp1016 study) from:

      • Confirmed syphilis cases at different disease stages

      • Healthy controls

      • Patients with potentially cross-reactive conditions (leptospirosis, Lyme disease, hepatitis B, tuberculosis, autoimmune disorders)

  • Statistical analysis of diagnostic performance:

    • Calculation of sensitivity, specificity, positive and negative predictive values

    • Determination of kappa (κ) values for agreement with clinical diagnosis

    • Comparison with established commercial tests (e.g., LICA Syphilis TP test)

Based on results from related T. pallidum proteins, a promising diagnostic antigen should demonstrate high sensitivity (>95%) and specificity (>98%), with strong agreement with clinical diagnosis (κ > 0.9) . These benchmarks were achieved by Tp0100 and would serve as appropriate targets for evaluating TP_0070's diagnostic potential.

How can fluorescent protein tagging be applied to study the localization and dynamics of TP_0070?

Fluorescent protein tagging of TP_0070 can provide critical insights into its subcellular localization, dynamics, and potential interactions with host cells. Building on recent advances in genetic manipulation of T. pallidum, the following approach is recommended:

  • Construct design and generation:

    • Create a fusion protein linking TP_0070 to a red-shifted Green Fluorescent Protein (GFP) similar to that used in the T. pallidum SS14 strain

    • Design constructs with both N-terminal and C-terminal tags to determine which orientation preserves protein function

    • Include a flexible linker sequence between TP_0070 and the fluorescent tag to minimize structural interference

  • Expression validation:

    • Confirm expression of the fusion protein by Western blotting

    • Verify that tagging doesn't disrupt protein folding through functional assays

  • Microscopy-based analyses:

    • Perform live-cell imaging to track TP_0070 localization in real-time

    • Use confocal microscopy to determine precise subcellular localization

    • Employ super-resolution techniques (STORM, PALM) for detailed localization studies

  • Host-pathogen interaction studies:

    • Co-culture tagged T. pallidum with mCherry-membrane/BFP-nucleus labeled host cells (such as Sf1Ep cells) to visualize interactions

    • Use time-lapse microscopy to capture dynamic interactions during infection

    • Analyze co-localization with host cell structures to identify potential binding partners

  • Fluorescence-based sorting and analysis:

    • Use fluorescence-activated cell sorting (FACS) to isolate bacterial populations with different expression levels

    • Perform flow cytometry analysis to quantify expression under various conditions

This approach would build on the successful fluorescent tagging of T. pallidum described in recent research, which demonstrated the feasibility of expressing fluorescent proteins in this challenging organism . The multi-color system with GFP-tagged bacteria and mCherry/BFP-labeled host cells provides an excellent platform for studying host-pathogen interactions with unprecedented visual clarity.

What strategies can resolve expression challenges when working with difficult-to-express T. pallidum proteins?

Uncharacterized T. pallidum proteins like TP_0070 often present significant expression challenges. Based on experience with other treponemal proteins, the following comprehensive troubleshooting strategies are recommended:

  • Vector and fusion tag optimization:

    • Test multiple fusion tags beyond the standard His-tag (GST, MBP, SUMO, Trx)

    • Compare different vector backbones with varying promoter strengths

    • Evaluate the impact of tag position (N-terminal vs. C-terminal)

  • Codon optimization:

    • Analyze the TP_0070 sequence for rare codons in the expression host

    • Generate a codon-optimized synthetic gene for the expression system

    • Co-express rare tRNAs using plasmids like pRARE

  • Expression host diversification:

    • Test specialized E. coli strains (Rosetta, Origami, ArcticExpress, SHuffle)

    • Consider alternative expression systems (Bacillus, yeast, insect cells)

    • Evaluate cell-free expression systems for highly toxic proteins

  • Induction parameter optimization through factorial design:

    • Apply a systematic factorial design approach as described for other recombinant proteins

    • Include variables such as:

      • Induction temperature (15-37°C)

      • Inducer concentration (0.01-1.0 mM IPTG)

      • Media composition (minimal vs. rich media)

      • Growth phase at induction (early, mid, late log phase)

      • Duration of induction (2-24 hours)

  • Solubility enhancement strategies:

    • Co-expression with molecular chaperones (GroEL/ES, DnaK/J, trigger factor)

    • Addition of solubility enhancers to the media (sorbitol, glycine betaine)

    • Use of specialized solubility-enhancing tags (SUMO, MBP)

For proteins expressed as inclusion bodies, an optimized refolding protocol should be developed:

  • Systematic screening of refolding buffers with different pH, ionic strength, and additives

  • Evaluation of refolding methods (rapid dilution, on-column refolding, dialysis)

  • Addition of stabilizing agents (arginine, trehalose, glycerol)

The experimental design approach, as demonstrated for pneumolysin expression, provides a statistical framework to efficiently optimize multiple parameters simultaneously rather than the traditional one-factor-at-a-time approach .

How can computational approaches complement experimental work with TP_0070?

Computational methods can significantly enhance experimental research on TP_0070, providing direction and context for laboratory studies. An integrated computational-experimental workflow would include:

  • Structure prediction and analysis:

    • Generate accurate 3D models using AlphaFold2 or RoseTTAFold

    • Identify potential binding sites and functional domains through computational pocket detection

    • Perform molecular dynamics simulations to understand protein flexibility

    • Use the structural predictions to guide mutation studies and protein engineering

  • Systems biology approaches:

    • Integrate TP_0070 into protein-protein interaction networks of T. pallidum

    • Predict metabolic pathways the protein might participate in

    • Model the potential impact of TP_0070 knockout on bacterial fitness

  • Comparative genomics:

    • Analyze TP_0070 conservation across different T. pallidum strains and subspecies

    • Identify orthologs in related organisms that may have better-characterized functions

    • Perform evolutionary analysis to identify conserved residues likely critical for function

  • Immunoinformatics:

    • Predict B-cell and T-cell epitopes to guide immunological studies

    • Evaluate potential cross-reactivity with human proteins

    • Design peptide arrays based on computational predictions for epitope mapping

  • Machine learning applications:

    • Train models on known T. pallidum protein functions to predict TP_0070 function

    • Use natural language processing to mine literature for relevant information

    • Develop classification algorithms to predict protein localization

The results from these computational approaches should directly inform experimental design, creating a virtuous cycle where experimental data refines computational models, which in turn guide more targeted experiments. This integrated approach maximizes research efficiency and accelerates characterization of uncharacterized proteins like TP_0070.

How can researchers validate the correct folding of recombinant TP_0070?

Confirming proper folding of recombinant TP_0070 is critical for functional studies. A comprehensive validation approach should include:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Intrinsic tryptophan fluorescence to evaluate tertiary structure

    • Differential scanning fluorimetry (DSF) to determine thermal stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm oligomeric state

  • Functional validation:

    • If computational analysis suggests enzymatic activity, perform specific activity assays

    • For proteins with unknown function, binding assays with predicted interaction partners

    • Compare activity metrics with native protein when possible

  • Immunological recognition:

    • Western blotting with conformation-specific antibodies if available

    • ELISA using sera from T. pallidum-infected hosts, which should recognize properly folded epitopes

    • Comparison of recognition patterns between reduced/denatured and native forms

  • Structural integrity assessment:

    • Limited proteolysis to probe accessibility of cleavage sites

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to assess solvent accessibility

    • Nuclear magnetic resonance (NMR) spectroscopy for smaller proteins

For TP_0070, without known function, immunological recognition may be particularly valuable as an initial validation step. If the recombinant protein is recognized by antibodies from infected hosts but not by healthy controls (similar to observations with Tp0100 and Tp1016), this suggests proper folding of immunologically relevant epitopes . Ultimately, multiple complementary methods should be employed to build confidence in the protein's structural integrity.

What strategies help overcome low expression yields of T. pallidum proteins?

Low expression yields are a common challenge when working with T. pallidum proteins. Based on successful approaches with other difficult-to-express proteins, the following strategies can significantly improve yields:

  • Expression system optimization:

    • Compare batch vs. fed-batch cultivation

    • Evaluate auto-induction media which often produces higher cell densities

    • Test high-density cultivation methods using controlled bioreactors

    • Consider alternate promoters (trc, tac, araBAD) if T7 system yields are low

  • Scale-up considerations:

    • Optimize oxygen transfer and mixing in larger culture volumes

    • Implement feeding strategies to maintain nutrient availability

    • Monitor and control pH during extended cultivations

    • Apply statistical process control methods to ensure consistency

  • Post-translational modifications:

    • If glycosylation is predicted, consider eukaryotic expression systems

    • For disulfide bond-rich proteins, evaluate specialized E. coli strains (SHuffle, Origami)

    • Test expression with and without signal sequences for secreted proteins

  • Process integration:

    • Develop optimized downstream processing workflows to minimize losses

    • Consider direct capture from cell lysate using expanded bed adsorption

    • Implement continuous processing where applicable

    • Explore refolding during purification for inclusion body proteins

  • Yield enhancement additives:

    • Add chemical chaperones to the growth medium (ethanol, DMSO, glycerol)

    • Test the effect of osmolytes (sorbitol, trehalose) on protein stability

    • Evaluate metal ion supplementation if the protein contains metal-binding sites

    • Consider amino acid supplementation, particularly for cysteine-rich proteins

This systematic approach should be guided by experimental design principles, as demonstrated in the factorial design study for recombinant protein expression . By simultaneously evaluating multiple parameters, researchers can identify optimal conditions more efficiently than with traditional methods. For T. pallidum proteins, yields of 75-250 mg/L have been achieved through such optimization , providing reasonable targets for TP_0070 expression.

How should researchers approach contradictory results when characterizing novel T. pallidum proteins?

When faced with contradictory results during characterization of novel proteins like TP_0070, a systematic troubleshooting approach is essential:

  • Data validation and quality assessment:

    • Evaluate the reproducibility of contradictory results through multiple independent experiments

    • Assess technical variability using appropriate controls and standards

    • Review raw data for anomalies or outliers that might explain discrepancies

    • Consider blinded analysis to eliminate bias

  • Methodological reconciliation:

    • Compare experimental conditions between contradictory experiments in detail

    • Evaluate whether differences in protein preparation could explain discrepancies

    • Consider if the protein batch variability impacts results

    • Assess whether different detection methods have varying sensitivities or specificities

  • Hypothesis refinement:

    • Develop alternative hypotheses that could explain apparently contradictory results

    • Design critical experiments specifically to differentiate between competing hypotheses

    • Consider if contradictions suggest multiple functions or conformational states

    • Evaluate whether post-translational modifications might explain functional differences

  • Computational analysis:

    • Use modeling to explore different potential states or conformations

    • Apply statistical approaches to determine if contradictions are statistically significant

    • Conduct meta-analysis if multiple datasets are available

    • Employ machine learning to identify patterns in complex, seemingly contradictory data

  • Consultation and collaboration:

    • Seek input from researchers with expertise in different methodologies

    • Consider collaborative studies to validate findings across laboratories

    • Present contradictory results at conferences to gather feedback

    • Explore whether literature on related proteins shows similar contradictions

This structured approach allows researchers to transform contradictory results from a frustration into an opportunity for deeper understanding. As highlighted in research with other T. pallidum proteins, seemingly contradictory results often reflect the complex biology of these multifunctional proteins rather than experimental error . By systematically analyzing discrepancies, researchers can develop more nuanced and comprehensive models of protein function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.