Recombinant Treponema pallidum Uncharacterized protein TP_0138 (TP_0138)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
TP_0138; Uncharacterized protein TP_0138
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0138
Target Protein Sequence
MQPPRPACQDEGTHGKEVCMLLIQKKRLLVVLIVSFLSILFSAGYAFRIGMLHAHKGSAE TILFYGFVAAAFHFILSLYLMLHAHHKKKELLKLADMLRYGGSIGESHFKKFGVLGTQIQ FLLKELLALSAQKSLKIAALSGLQRALTELIPTPVIIIDLNGTILDMTKGARKRVQRADK TLTIEHIFPATDSTRAVQEAEKTHTPVEQEGGIVFIPVFSAVGNISHFLVDISKQPASDE PLSLA
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0138

STRING: 243276.TP0138

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing Recombinant TP_0138?

Multiple expression systems can be used to produce TP_0138, each with specific advantages:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliCost-effective, rapid growth, high yields, simplified purificationMay lack proper post-translational modifications, potential inclusion body formation10-100 mg/L
YeastEukaryotic post-translational modifications, secretion capabilityLonger expression time, hyperglycosylation risk5-50 mg/L
BaculovirusComplex eukaryotic modifications, proper folding of complex proteinsHigher cost, specialized expertise required1-50 mg/L
Mammalian cellsMost authentic post-translational modifications, proper foldingHighest cost, lowest yields, complex maintenance0.1-10 mg/L

The choice of expression system should be guided by the specific research application. For structural studies requiring high purity but not necessarily native modifications, E. coli is often preferred. For functional studies where post-translational modifications may be critical, eukaryotic systems may yield more biologically relevant protein .

How should researchers design experiments to characterize the function of TP_0138?

Characterizing an uncharacterized protein like TP_0138 requires a systematic experimental approach:

  • Sequence analysis and computational prediction:

    • Perform bioinformatic analyses to identify conserved domains, motifs, or homology to proteins of known function

    • Use protein structure prediction software to generate hypotheses about potential functions

  • Expression and localization studies:

    • Determine the subcellular localization in T. pallidum using immunoelectron microscopy

    • Assess expression levels during different growth phases and infection stages using RT-qPCR

  • Protein interaction studies:

    • Conduct pull-down assays or yeast two-hybrid screening to identify binding partners

    • Perform co-immunoprecipitation to confirm interactions in native conditions

  • Functional assays:

    • Design knockout or knockdown experiments (if genetic manipulation is possible)

    • Assess phenotypic changes in adhesion, motility, or host cell interaction

  • Immunological studies:

    • Evaluate immunogenicity in animal models

    • Assess reactivity with sera from patients at different stages of syphilis infection

For each experiment, include appropriate controls and replicate trials (minimum three) to ensure statistical validity. Document all observations in standardized data tables with clear titles, labeled columns including units, and proper organization of independent and dependent variables .

What standardized protocols exist for analyzing TP_0138 immunogenicity?

When investigating the immunogenicity of TP_0138, researchers should follow a structured experimental protocol:

Protocol for Assessing TP_0138 Immunogenicity:

  • Serum Sample Collection:

    • Collect serum samples from:

      • Patients with confirmed primary, secondary, latent, and tertiary syphilis

      • Healthy controls

      • Patients with other spirochetal diseases (e.g., Lyme disease, leptospirosis)

    • Ensure proper ethical approval and informed consent

  • ELISA Assay Setup:

    • Coat 96-well plates with purified recombinant TP_0138 (2-5 μg/ml)

    • Block with BSA or suitable blocking buffer

    • Add serially diluted patient sera (1:100 to 1:3200)

    • Use appropriate secondary antibodies

    • Measure absorbance at 450 nm

  • Data Collection and Analysis:

    Sample GroupNumber of SamplesSeropositivity RateAverage Absorbance (OD 450nm)Standard Deviation
    Primary syphilisn = ______%__________
    Secondary syphilisn = ______%__________
    Latent syphilisn = ______%__________
    Tertiary syphilisn = ______%__________
    Healthy controlsn = ______%__________
    Other spirochetal diseasesn = ______%__________
  • Statistical Analysis:

    • Calculate sensitivity and specificity

    • Generate ROC curve and determine AUC

    • Perform statistical tests to assess significance of differences between groups

This protocol follows principles similar to those used in evaluating other T. pallidum antigens like TpN17 and TmpA, which have demonstrated high diagnostic accuracy (sensitivities of 97.2% and 90.6%, respectively, with 100% specificity) .

How does TP_0138 compare with established diagnostic T. pallidum antigens?

When comparing TP_0138 with well-characterized T. pallidum antigens used in diagnostic applications, researchers should consider several parameters:

AntigenMolecular WeightLocalizationImmunodominanceStage-Specific ReactivitySensitivitySpecificity
Tp15 (Tp0171)15 kDaInner membraneHighAll stages95-99%95-99%
Tp17 (Tp0435)17 kDaOuter membraneHighAll stages97.2%100%
Tp47 (Tp0574)47 kDaInner membraneHighAll stages95-99%95-99%
TmpA (Tp0768)44.5 kDaInner membraneModerateSecondary/latent90.6%100%
TP_0138~30 kDaUncharacterizedUnknownUnknownTo be determinedTo be determined

Established antigens like Tp17 and Tp47 are immunodominant lipoproteins that have proven highly effective for syphilis screening . TP_0138, being uncharacterized, requires comprehensive comparative analysis to determine its potential value in diagnostic applications. Research should focus on determining whether TP_0138 offers advantages such as:

  • Earlier detection in primary syphilis

  • Better discrimination between active and past infection

  • Improved monitoring of treatment response

  • Complementary diagnostic value when combined with established antigens

The methodological approach should include parallel testing of serum panels against TP_0138 and established antigens, followed by statistical analysis of diagnostic performance metrics .

What techniques can researchers use to investigate potential roles of TP_0138 in T. pallidum pathogenesis?

Investigating the potential role of TP_0138 in pathogenesis requires multiple experimental approaches:

  • Adhesion and Invasion Assays:

    • Test whether recombinant TP_0138 binds to human cell lines (epithelial, endothelial, fibroblasts)

    • Quantify adhesion using labeled protein and flow cytometry

    • Assess if antibodies against TP_0138 block T. pallidum adhesion to human cells

  • Immune Response Modulation:

    • Measure cytokine production (IL-1β, IL-6, TNF-α, IL-10) by human immune cells exposed to TP_0138

    • Assess activation of immune signaling pathways (NF-κB, MAPK)

    • Determine if TP_0138 affects neutrophil or macrophage function

  • In Vivo Studies:

    • Rabbit infection model with T. pallidum strains modified to overexpress or underexpress TP_0138

    • Histopathological examination of lesions

    • Quantification of bacterial dissemination

  • Structural Studies:

    • X-ray crystallography or cryo-EM to determine 3D structure

    • Identification of functional domains and potential binding sites

    • Comparison with virulence factors from other pathogens

Each approach should include appropriate controls and multiple biological replicates. Data should be presented in well-organized tables with clear headings, consistent units, and statistical analyses as appropriate .

How should researchers analyze conflicting data regarding TP_0138 immunoreactivity?

When faced with conflicting data regarding TP_0138 immunoreactivity, researchers should follow a systematic analytical approach:

  • Methodological Assessment:

    • Compare experimental protocols used in conflicting studies (antigen preparation, coating concentration, buffer compositions, blocking agents)

    • Assess differences in detection systems (enzyme conjugates, substrates, incubation times)

    • Evaluate sample handling and storage conditions

  • Sample Population Analysis:

    • Compare demographic characteristics of patient populations

    • Assess disease stage distribution across studies

    • Review treatment history of patients

  • Statistical Reanalysis:

    • Perform meta-analysis if sufficient studies are available

    • Calculate confidence intervals for reported sensitivities and specificities

    • Consider Bayesian approaches to reconcile conflicting results

  • Resolution Strategy:

    • Design validation experiments addressing specific methodological discrepancies

    • Perform blinded multi-center studies with standardized protocols

    • Consider epitope mapping to identify immunodominant regions that may explain differential reactivity

This approach aligns with strategies used to resolve conflicting data for other T. pallidum antigens. For example, TmpA has shown variable immunoreactivity across studies, with some reporting strong reactivity with sera from primary syphilis patients while others finding stronger associations with secondary or latent infection stages .

What approaches should be used for quantitative analysis of TP_0138 expression during different stages of syphilis?

Quantitative analysis of TP_0138 expression requires precision and methodological rigor:

  • Sample Collection and Processing:

    • Obtain samples from rabbit model at defined intervals post-infection

    • Extract RNA using methods optimized for low-biomass, fastidious organisms

    • Include appropriate extraction controls

  • RT-qPCR Protocol:

    • Design primers specific to TP_0138 with minimal cross-reactivity

    • Use multiple reference genes for normalization (16S rRNA, DNA polymerase I)

    • Include standard curves for absolute quantification

  • Data Collection and Analysis Template:

    Infection StageSample IDCT Value TP_0138CT Value Ref Gene 1CT Value Ref Gene 2Normalized ExpressionFold Change
    Primary (7d)S1
    Primary (14d)S2
    Secondary (28d)S3
    Secondary (42d)S4
    Latent (90d)S5
    Latent (180d)S6
  • Statistical Analysis:

    • Apply appropriate normalization methods (ΔΔCt or standard curve)

    • Perform ANOVA or non-parametric tests as appropriate

    • Calculate confidence intervals for expression levels

This methodology is based on approaches used in molecular studies of T. pallidum gene expression, which demonstrated varying expression patterns of different antigens during infection progression .

What ethical considerations should researchers be aware of when conducting human studies with T. pallidum antigens like TP_0138?

Research involving T. pallidum antigens carries significant ethical responsibilities, particularly in light of historical injustices like the Tuskegee Syphilis Study (1932-1972) :

  • Informed Consent Requirements:

    • Provide clear, accessible information about study purpose and procedures

    • Ensure participants understand their right to withdraw

    • Use culturally and linguistically appropriate consent processes

    • Include information about potential benefits and risks

  • Sample Collection and Storage Ethics:

    • Obtain specific consent for sample storage and future use

    • Address ownership of biological materials and derived data

    • Establish transparent governance for biorepositories

  • Community Engagement:

    • Involve affected communities in research design and implementation

    • Share research findings with participating communities

    • Address historical mistrust related to syphilis research

  • Scientific Integrity Considerations:

    • Register clinical studies prior to commencement

    • Commit to publishing all results, including negative findings

    • Follow standardized reporting guidelines

The Tuskegee Syphilis Study represents a profound ethical failure where treatment was deliberately withheld from African American men with syphilis, even after effective treatment became available . Modern syphilis research must actively incorporate ethical principles established in response to this tragedy, including the 1979 Belmont Report's emphasis on respect for persons, beneficence, and justice .

How should researchers approach the development of TP_0138-based diagnostic tools with considerations for global health equity?

When developing diagnostic tools based on TP_0138 or other T. pallidum antigens, researchers should consider global health equity implications:

  • Affordability and Access Planning:

    • Consider cost implications of different production systems

    • Design tests that can function in resource-limited settings

    • Plan for technology transfer to affected regions

  • Validation Across Diverse Populations:

    • Include samples from diverse geographic and demographic groups

    • Assess test performance in populations with different genetic backgrounds

    • Validate in settings with varying syphilis epidemiology

  • Implementation Research:

    • Study barriers to adoption in different healthcare systems

    • Develop appropriate training materials for various contexts

    • Plan for sustainability beyond research funding

  • Intellectual Property Considerations:

    • Consider frameworks that protect innovation while ensuring access

    • Explore collaborative licensing models

    • Develop strategies for affordable manufacturing and distribution

Syphilis disproportionately affects resource-limited settings, with an estimated 6.3 million cases occurring annually in these regions . Diagnostic innovations should be developed with consideration for deployment in areas of greatest need, not only in well-resourced research settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.