Recombinant Treponema pallidum Uncharacterized protein TP_0173 (TP_0173)

Shipped with Ice Packs
In Stock

Description

Introduction

Treponema pallidum is a bacterium that causes syphilis, a sexually transmitted infection with diverse clinical manifestations . Accurate diagnosis is critical for controlling the spread of syphilis, but it can be challenging due to the varying clinical forms and the potential for serological tests to yield inaccurate results . Recombinant Treponema pallidum proteins, such as TP_0173, have become vital in enhancing the accuracy of serological testing . While TP_0173 has been identified as antigenic and has shown potential in diagnostic applications, its precise function remains uncharacterized.

Identification and Characteristics

TP_0173 is a protein of Treponema pallidum that has been recognized for its immunoreactivity . Studies have identified several immunoreactive T. pallidum proteins with diagnostic biomarker potential, and TP_0173 is among those that have shown promise .

Diagnostic Potential

Several recombinant T. pallidum proteins have been assessed for syphilis diagnosis, and they are crucial to achieve high accuracy in serological testing . In one study, two recombinant proteins, TpN17 and TmpA, were evaluated for detecting specific anti-T. pallidum antibodies in the serum of syphilis-positive individuals using the ELISA diagnostic platform .

Diagnostic Performance of TpN17 and TmpA

ParameterTpN17TmpA
Area Under the Curve (AUC)>99%>99%
Accuracy>95%>95%
Sensitivity97.2%90.6%
Specificity100%100%

Limitations and Future Directions

Studies evaluating the diagnostic performance of recombinant proteins like TpN17 and TmpA have faced limitations, such as the absence of syphilis samples from pregnant women and cases of congenital syphilis, as well as the lack of samples from individuals with tertiary syphilis . These limitations restrict the evaluation of the diagnostic performance of both recombinant proteins . Future research should focus on utilizing antigenic mixtures to enhance sensitivity and address the limitations of current studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TP_0173; Uncharacterized protein TP_0173
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0173
Target Protein Sequence
MYFAILGTMSRTCVRAYAVFAIAIMVLTVAWFAFSISQAIQRNTVGAQQRFAQVIRRIAP RVTSKRQLTDAEADFIQNLCKNDDLIMALNIFSNRVQLFSWTYDDLMFVAGGGSELVPRS SSLFIKIFSGRVPYQAKDECLLFTAALRVLTPANIFFRGCVVFLVMLTLTISSMVFLVIE YLSVRRFQCAQGDARPRPAGPQGTARSRTDEAQVSPGTPPECPVSVF
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0173

STRING: 243276.TP0173

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Treponema pallidum TP_0173 and why is it significant for research?

TP_0173 is an uncharacterized protein from Treponema pallidum, the bacterium that causes syphilis. This protein is significant for research because it represents one of several proteins in T. pallidum whose functions remain to be fully elucidated. T. pallidum is a challenging organism to study as it has historically been difficult to culture in laboratory settings, making recombinant proteins like TP_0173 valuable tools for investigating the pathogen's biology . The protein is encoded by the TP_0173 gene in the T. pallidum genome (strain Nichols) and is registered in UniProt with the accession number O83203 . Understanding TP_0173 may contribute to our knowledge of T. pallidum pathogenesis and potentially inform therapeutic approaches against syphilis.

How should researchers design experiments to investigate the function of TP_0173?

When designing experiments to investigate uncharacterized proteins like TP_0173, researchers should follow a systematic approach:

  • Define clear research questions and variables: Begin with specific hypotheses about potential functions based on sequence homology or structural predictions .

  • Consider both independent and dependent variables: For example:

Research QuestionIndependent VariableDependent VariablePossible Control
Role of TP_0173 in membrane integrityTP_0173 expression levelsMembrane permeabilityKnown membrane protein
TP_0173 interaction with host cellsPresence/absence of TP_0173Host cell adhesionOther T. pallidum adhesins
Environmental regulation of TP_0173Temperature/pH conditionsTP_0173 expression levelsHousekeeping gene expression
  • Control extraneous variables: When studying T. pallidum proteins, considerations should include:

    • Genetic background of bacterial strains

    • Growth conditions

    • Protein expression methods

    • Host cell types (if relevant)

    • Detection methods specificity

  • Assign appropriate experimental groups: Using either between-subjects design (different samples for each condition) or within-subjects design (same sample under different conditions) depending on the research question .

  • Choose appropriate measurement techniques: Such as immunoassays, functional assays, or structural analyses based on the protein's predicted properties .

What controls should be included when working with recombinant TP_0173?

When designing experiments with recombinant TP_0173, the following controls should be considered:

  • Positive controls: Include well-characterized proteins from T. pallidum with known functions or localization patterns.

  • Negative controls:

    • Samples without the protein of interest

    • Samples with a non-relevant protein expressed using the same system

    • For binding studies: blocked binding sites or competitive inhibition controls

  • Expression system controls: To verify that any observed effects are due to TP_0173 itself and not artifacts from the expression system.

  • Antibody specificity controls: When using antibody-based detection methods, include controls for non-specific binding.

  • Environmental condition controls: Maintain consistent temperature, pH, and ionic strength across experimental conditions .

What are the challenges and solutions for expressing TP_0173 given T. pallidum's cultivation difficulties?

Treponema pallidum has historically been extremely difficult to culture in laboratory settings. According to research, T. pallidum "is only found in humans" and "not found anywhere else in nature," making it challenging to obtain sufficient quantities for protein studies . Recent advances have improved cultivation possibilities:

Challenges:

  • T. pallidum's extreme host dependence

  • Fastidious growth requirements

  • Limited viability outside of host environment

  • Low protein expression levels

Solutions:

  • Recombinant protein expression: The most practical approach for studying TP_0173 is through recombinant expression in laboratory-amenable hosts like E. coli, which allows for production of sufficient quantities for research .

  • Novel co-culture systems: Researchers have developed a co-incubation system where T. pallidum can be grown in rabbit epithelial cells with periodic amino acid supplementation. This system has maintained infectious spirochetes for over eight months continuously and could potentially be adapted to study native TP_0173 expression .

  • Tissue-mimicking conditions: Creating environments that mimic the natural habitat of T. pallidum by "creating tissue-like conditions" has proven successful for maintaining viable organisms .

  • Transfer protocols: Regular transfer of infected cells to fresh culture medium (approximately weekly) helps maintain near-homeostatic conditions for the bacteria .

How should recombinant TP_0173 be stored and handled for optimal stability?

For optimal stability and activity of recombinant TP_0173:

  • Storage recommendations:

    • Store at -20°C for regular use

    • For extended storage, conserve at -20°C or -80°C

    • Working aliquots can be stored at 4°C for up to one week

  • Buffer composition:

    • Use Tris-based buffer with 50% glycerol, optimized for this protein

    • The specific buffer composition may need to be adjusted based on downstream applications

  • Handling precautions:

    • Avoid repeated freezing and thawing cycles as this can lead to protein degradation

    • Prepare small working aliquots to minimize freeze-thaw cycles

    • Use sterile techniques to prevent contamination

How do sequencing approaches compare for investigating TP_0173 across different T. pallidum strains?

Various sequencing approaches have been used to analyze T. pallidum genomes, each with advantages for specific research questions about genes like TP_0173:

Sequencing MethodAdvantagesLimitationsApplication to TP_0173
Sanger sequencing (DDT)High accuracy for specific regionsLabor-intensive, limited throughputVerification of specific mutations in TP_0173
454 sequencingModerate read length (~233bp), good for assemblyHigher error rate in homopolymer regionsInitial genome assembly including TP_0173 region
Illumina/SolexaHigh throughput, low error rateShorter read length (~35bp)Deep coverage of TP_0173 for variant detection
Comparative Genome Sequencing (CGS)Efficient for comparing related strainsMay miss structural variationsIdentifying SNPs in TP_0173 between strains
Combined approachComprehensive and high confidenceResource intensiveMost accurate characterization of TP_0173 variations

Research on T. pallidum has employed multiple sequencing strategies, often in combination. For example, studies have used 454 sequencing to achieve approximately 27× depth coverage with an average read length of 100bp, assembled into contigs covering 98.6% of the reference genome . When combined with Solexa sequencing (206× coverage), researchers were able to fill gaps using dideoxy-terminator sequencing methods .

What bioinformatic approaches are most effective for analyzing uncharacterized proteins like TP_0173?

For uncharacterized proteins like TP_0173, several bioinformatic approaches can yield valuable insights:

  • Sequence homology analysis: Compare TP_0173 to characterized proteins in other organisms to identify possible functions.

  • Structural prediction: Use tools like AlphaFold or I-TASSER to predict 3D structure, which may suggest functional domains.

  • Genomic context analysis: Examine nearby genes that may be functionally related or co-regulated with TP_0173.

  • Whole genome fingerprinting (WGF): This technique has been used to verify genome assemblies in T. pallidum research by comparing experimental restriction enzyme analysis with in silico predictions .

  • Cross-strain comparison: Analyzing TP_0173 sequences across different T. pallidum strains can identify conserved regions that may be functionally important. This approach can utilize both script-based software and whole genome alignments with manual corrections .

  • Gene annotation transfer: Utilize annotations from well-studied strains like Nichols to predict gene coordinates and functions in other T. pallidum strains .

How can researchers resolve contradictory findings about TP_0173 in the scientific literature?

Contradictions in scientific literature regarding proteins like TP_0173 are common and can arise from multiple sources. Researchers can address these contradictions through systematic context analysis:

  • Identify the specific claim discrepancies: Clearly define what aspects of TP_0173 findings appear contradictory (e.g., expression patterns, localization, functional characteristics) .

  • Analyze contextual differences: Most contradictions in biomedical literature stem from underspecified context, including:

    • Species differences

    • Temporal context variations

    • Environmental phenomena

    • Methodological variations

  • Standardize entity normalization: Ensure gene/protein normalization is performed consistently to account for lexical variability in how TP_0173 is referenced .

  • Evaluate claim specificity: Incomplete context can create apparent contradictions (e.g., "TP_0173 is expressed in condition X" vs. "TP_0173 is not expressed") .

  • Consider polarity computation: Automated approaches can help detect contradicting events by computing their polarity across large literature sets .

  • Develop standardized questions: For systematic reviews, develop specific yes/no questions about TP_0173 to categorize claims that support different answers .

  • Perform controlled replication: Design experiments that specifically address the contradictory findings under standardized conditions.

What experimental approaches can help validate contradictory findings about TP_0173?

When facing contradictory findings about TP_0173 in the literature, several experimental validation approaches can help resolve discrepancies:

  • Replicate studies with standardized protocols: Repeat key experiments using identical methods, reagents, and conditions to determine reproducibility.

  • Vary experimental conditions systematically: Methodically change one variable at a time (temperature, pH, cell type, etc.) to identify condition-dependent effects.

  • Cross-validate with multiple techniques: Confirm results using different experimental approaches (e.g., confirming protein expression using both Western blotting and mass spectrometry).

  • Use genetic manipulation: Create knockout/knockdown strains or express TP_0173 in heterologous systems to directly test functional hypotheses.

  • Collaborative validation: Engage multiple laboratories to independently test the same hypotheses with the same protocols.

  • Meta-analysis: Quantitatively combine results from multiple studies to identify patterns and sources of heterogeneity in findings.

  • Context-specific testing: If contradictions appear related to specific contexts (e.g., expression in different tissues or growth conditions), design experiments that explicitly test these contextual factors .

What techniques can determine the cellular localization and membrane topology of TP_0173?

Determining the cellular localization and membrane topology of TP_0173 requires specialized techniques:

  • Immunofluorescence microscopy: Using specific antibodies against TP_0173 to visualize its location within bacterial cells.

  • Subcellular fractionation: Separating bacterial cell components (cytoplasm, inner membrane, periplasm, outer membrane) followed by Western blotting to detect TP_0173.

  • PhoA/LacZ fusion analysis: Creating fusion proteins with reporter enzymes to determine membrane topology by assessing which portions of the protein are accessible.

  • Protease accessibility assays: Treating intact cells with proteases that cannot penetrate the membrane, then analyzing which regions of TP_0173 are protected.

  • Cysteine accessibility methods: Introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable sulfhydryl reagents.

  • Membrane extraction studies: Using different detergents to solubilize membrane proteins can provide information about membrane association strength and type.

  • Cryo-electron microscopy: For high-resolution structural analysis of membrane proteins in their native environment.

These techniques can be particularly valuable for TP_0173, as its amino acid sequence suggests potential membrane-associated domains that may be critical to its function .

How can researchers determine potential binding partners and interaction networks for TP_0173?

To identify binding partners and establish interaction networks for TP_0173:

  • Yeast two-hybrid (Y2H) screening: A classic approach for detecting protein-protein interactions in a high-throughput manner.

  • Pull-down assays: Using tagged recombinant TP_0173 to capture interacting proteins from bacterial or host cell lysates.

  • Co-immunoprecipitation (Co-IP): Precipitating TP_0173 from cell lysates using specific antibodies and identifying co-precipitated proteins.

  • Proximity labeling techniques: Methods like BioID or APEX that tag proteins in close proximity to TP_0173 in living cells.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding affinities between TP_0173 and potential partners.

  • Protein microarrays: Screening against arrays of host proteins to identify potential interactions.

  • Cross-linking mass spectrometry: Capturing transient interactions through chemical cross-linking followed by mass spectrometry identification.

  • Bacterial two-hybrid systems: Similar to Y2H but conducted in bacterial cells, which may be more appropriate for bacterial proteins.

  • Computational prediction: Using algorithms that predict protein-protein interactions based on sequence, structure, and co-expression data.

  • Fluorescence resonance energy transfer (FRET): For detecting protein interactions in real-time in living cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.